DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafga

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_021325832.1 Gene:mafga / 415134 ZFINID:ZDB-GENE-040624-7 Length:234 Species:Danio rerio


Alignment Length:97 Identity:52/97 - (53%)
Similarity:77/97 - (79%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYE 91
            :|||:|||:|||:||:.|  |||.::||:::|||||||||||||||||:||:.||:|||.:|:..
Zfish    96 LTDDELVSMSVRELNQHL--RGLTKDEILQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAEL 158

  Fly    92 WTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ..|:|::..:|..::.|:...::||:||..||
Zfish   159 QQEVEKLASENASMKVELDVLRSKYEALQSFA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 34/68 (50%)
coiled coil 59..110 CDD:269865 28/50 (56%)
mafgaXP_021325832.1 bZIP_Maf_small 118..187 CDD:269865 34/68 (50%)
coiled coil 118..187 CDD:269865 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576606
Domainoid 1 1.000 103 1.000 Domainoid score I6715
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4897
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm24733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.