DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafk

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_005164260.1 Gene:mafk / 415133 ZFINID:ZDB-GENE-040624-9 Length:157 Species:Danio rerio


Alignment Length:99 Identity:53/99 - (53%)
Similarity:77/99 - (77%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKS 89
            |.::||:||::|||:||:.|  |||.:|::||:||||||||||||||||||||:.||:|||.:|:
Zfish    25 PALSDDELVAMSVRELNQHL--RGLTKEDVVRLKQRRRTLKNRGYAASCRIKRVTQKEELERQKT 87

  Fly    90 YEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ....|::::..:|..:|.|:...:.||:||..||
Zfish    88 ELQHEVDKLARENASMRLELDALRAKYEALQCFA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 29/50 (58%)
mafkXP_005164260.1 bZIP_Maf_small 49..118 CDD:269865 36/68 (53%)
coiled coil 49..118 CDD:269865 36/68 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576609
Domainoid 1 1.000 103 1.000 Domainoid score I6715
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1770
Inparanoid 1 1.050 107 1.000 Inparanoid score I4897
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm24733
orthoMCL 1 0.900 - - OOG6_108977
Panther 1 1.100 - - LDO PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.