Sequence 1: | NP_001286639.1 | Gene: | maf-S / 37336 | FlyBaseID: | FBgn0034534 | Length: | 137 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002350.1 | Gene: | MAFG / 4097 | HGNCID: | 6781 | Length: | 162 | Species: | Homo sapiens |
Alignment Length: | 97 | Identity: | 52/97 - (53%) |
---|---|---|---|
Similarity: | 78/97 - (80%) | Gaps: | 2/97 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYE 91
Fly 92 WTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
maf-S | NP_001286639.1 | bZIP_Maf_small | 51..120 | CDD:269865 | 36/68 (53%) |
coiled coil | 59..110 | CDD:269865 | 28/50 (56%) | ||
MAFG | NP_002350.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | 52/97 (54%) | |
bZIP_Maf_small | 46..115 | CDD:269865 | 36/68 (53%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 53..76 | 19/22 (86%) | |||
coiled coil | 54..105 | CDD:269865 | 28/50 (56%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 79..93 | 5/13 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143691 | |
Domainoid | 1 | 1.000 | 102 | 1.000 | Domainoid score | I6837 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4196 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 107 | 1.000 | Inparanoid score | I4930 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1395389at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001412 | |
OrthoInspector | 1 | 1.000 | - | - | otm41661 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10129 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1287 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.860 |