DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and maff

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_956630.1 Gene:maff / 393307 ZFINID:ZDB-GENE-040426-1280 Length:158 Species:Danio rerio


Alignment Length:100 Identity:49/100 - (49%)
Similarity:74/100 - (74%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IPDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKK 88
            ||.::|.:|:|:|||:||  :.:|||:|||:.::|||||||||||||||||:||:.|::.||.:|
Zfish    21 IPVLSDSELMSLSVRELN--MHLRGLSREEVQKLKQRRRTLKNRGYAASCRVKRVSQREALEQQK 83

  Fly    89 SYEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            .....|:|::..:|..:|||:.....:..||.:||
Zfish    84 KELQQEVERLGAENAGMRRELEGLGARLAALQRFA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 33/68 (49%)
coiled coil 59..110 CDD:269865 28/50 (56%)
maffNP_956630.1 bZIP_Maf 24..115 CDD:281170 44/92 (48%)
coiled coil 46..115 CDD:269865 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576608
Domainoid 1 1.000 103 1.000 Domainoid score I6715
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4897
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm24733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.