DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafa

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_919331.1 Gene:Mafa / 378435 MGIID:2673307 Length:359 Species:Mus musculus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:70/92 - (76%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.|||:|||:|||  ::||.::||::|:||:||||||||||.|||.||::|:..||::|....
Mouse   234 SDDQLVSMSVRELNR--QLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQ 296

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            :::||:..:..::.:|...:|.||:.|
Mouse   297 SQVEQLKLEVGRLAKERDLYKEKYEKL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 59..110 CDD:269865 23/50 (46%)
MafaNP_919331.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..105
Maf_N 111..142 CDD:312029
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..226
bZIP_Maf_large 255..323 CDD:269866 30/67 (45%)
coiled coil 255..323 CDD:269866 30/67 (45%)
Basic motif 260..285 18/24 (75%)
Leucine-zipper 288..309 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..359 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.