DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafa

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_006241965.1 Gene:Mafa / 366949 RGDID:1562627 Length:361 Species:Rattus norvegicus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:70/92 - (76%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.|||:|||:|||  ::||.::||::|:||:||||||||||.|||.||::|:..||::|....
  Rat   236 SDDQLVSMSVRELNR--QLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQ 298

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            :::||:..:..::.:|...:|.||:.|
  Rat   299 SQVEQLKLEVGRLAKERDLYKEKYEKL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 59..110 CDD:269865 23/50 (46%)
MafaXP_006241965.1 Maf_N 111..141 CDD:312029
bZIP_Maf_large 257..325 CDD:269866 30/67 (45%)
coiled coil 257..325 CDD:269866 30/67 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.