DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and tj

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001260582.1 Gene:tj / 35227 FlyBaseID:FBgn0000964 Length:555 Species:Drosophila melanogaster


Alignment Length:105 Identity:42/105 - (40%)
Similarity:64/105 - (60%) Gaps:13/105 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 APLSPCPIPDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQK 81
            |.|..|    :.||.|.:::||:||:  ::.|..|||:||:||:||||||||||.:||.||:.|:
  Fly   391 ATLEDC----LNDDMLTTLTVRELNK--RLHGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQR 449

  Fly    82 DELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKALLQ 121
            .|||...       ..:::|..:::.|.|....:..||:|
  Fly   450 HELEKAN-------RVLNQDLHRLKLEYSRVCQERDALMQ 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 29/68 (43%)
coiled coil 59..110 CDD:269865 21/50 (42%)
tjNP_001260582.1 bZIP_Maf 397..486 CDD:281170 39/95 (41%)
coiled coil 419..486 CDD:269866 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.