DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafba

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_571090.2 Gene:mafba / 30210 ZFINID:ZDB-GENE-980526-515 Length:397 Species:Danio rerio


Alignment Length:92 Identity:44/92 - (47%)
Similarity:67/92 - (72%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.||::|||:|||.|  ||..::|::|:||:||||||||||.|||.||::||..||.:|:...
Zfish   285 SDDQLVTMSVRELNRHL--RGFTKDEVIRLKQKRRTLKNRGYAQSCRFKRVQQKHLLENEKTQLI 347

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            .::||:.::..::.||...:|.|.:.|
Zfish   348 NQVEQLKQEINRLARERDAYKLKCEKL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 51..120 CDD:269865 31/69 (45%)
mafbaNP_571090.2 Maf_N 122..157 CDD:462456
bZIP_Maf_large 306..375 CDD:269866 31/69 (45%)
coiled coil 306..375 CDD:269866 31/69 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.