DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafk

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_663706.2 Gene:Mafk / 246760 RGDID:628633 Length:156 Species:Rattus norvegicus


Alignment Length:99 Identity:54/99 - (54%)
Similarity:76/99 - (76%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKS 89
            |.::||:|||:|||:||:.|  |||.:||:.|:||||||||||||||||||||:.||:|||.::.
  Rat    22 PVLSDDELVSMSVRELNQHL--RGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRV 84

  Fly    90 YEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ....|:|::..:|..:|.|:...::||:||..||
  Rat    85 ELQQEVEKLARENSSMRLELDALRSKYEALQTFA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 29/50 (58%)
MafkNP_663706.2 bZIP_Maf_small 46..115 CDD:269865 36/68 (53%)
coiled coil 54..105 CDD:269865 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337427
Domainoid 1 1.000 102 1.000 Domainoid score I6669
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1770
Inparanoid 1 1.050 108 1.000 Inparanoid score I4814
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm45784
orthoMCL 1 0.900 - - OOG6_108977
Panther 1 1.100 - - LDO PTHR10129
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.