DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Maff

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_036015105.1 Gene:Maff / 17133 MGIID:96910 Length:267 Species:Mus musculus


Alignment Length:138 Identity:60/138 - (43%)
Similarity:86/138 - (62%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAK-----RERKSSLKCDFQAPLSPCPI----------PDITDDDLVSISVRDLNRTLKMRGLN 50
            :|||     .:|.||.|.... |||...:          |.::|:.|:.:|||:|||.|  |||:
Mouse    95 LEAKSQRSPAQRSSSAKMAVD-PLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNL--RGLS 156

  Fly    51 REEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNK 115
            .||:.|:|||||||||||||||||:||:.||:||:.:||....|::::..:|..:|.|:...:.|
Mouse   157 AEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGK 221

  Fly   116 YKALLQFA 123
            .:||..||
Mouse   222 CEALQGFA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 34/68 (50%)
coiled coil 59..110 CDD:269865 28/50 (56%)
MaffXP_036015105.1 bZIP_Maf_small 158..226 CDD:269865 34/67 (51%)
coiled coil 165..216 CDD:269865 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833879
Domainoid 1 1.000 102 1.000 Domainoid score I6813
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4906
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.