DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafb

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_034788.1 Gene:Mafb / 16658 MGIID:104555 Length:323 Species:Mus musculus


Alignment Length:122 Identity:52/122 - (42%)
Similarity:73/122 - (59%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QAPLS-PCPIPDIT-----------------DDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRR 62
            |.|.| |.|.|..|                 ||.|||:|||:|||.|  ||..::|::|:||:||
Mouse   182 QLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMSVRELNRHL--RGFTKDEVIRLKQKRR 244

  Fly    63 TLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKAL 119
            ||||||||.|||.||::||..||.:|:....::||:.::..::.||...:|.|.:.|
Mouse   245 TLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 51..120 CDD:269865 31/69 (45%)
MafbNP_034788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..78
Maf_N 80..113 CDD:462456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..210 7/27 (26%)
bZIP_Maf_large 233..302 CDD:269866 31/69 (45%)
coiled coil 233..302 CDD:269866 31/69 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 238..263 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 266..287 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.