DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and maff

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_002934281.1 Gene:maff / 100488557 XenbaseID:XB-GENE-489964 Length:148 Species:Xenopus tropicalis


Alignment Length:99 Identity:53/99 - (53%)
Similarity:77/99 - (77%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKS 89
            |.::||:|:|:|||:||..|  |||::||:||:|||||||||||||||||:||:.||:|||.:|.
 Frog    22 PLLSDDELMSMSVRELNHHL--RGLSKEEVVRLKQRRRTLKNRGYAASCRVKRVSQKEELEKQKK 84

  Fly    90 YEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ....|:|::.::|..::.|:...:.||:||..||
 Frog    85 DLQQEVEKLAQENSTIKLELDALRAKYEALQNFA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 28/50 (56%)
maffXP_002934281.1 bZIP_Maf_small 46..115 CDD:269865 36/68 (53%)
coiled coil 46..115 CDD:269865 36/68 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6708
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4766
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm48877
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.