DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafg

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_004916428.1 Gene:mafg / 100486278 XenbaseID:XB-GENE-989896 Length:220 Species:Xenopus tropicalis


Alignment Length:97 Identity:52/97 - (53%)
Similarity:79/97 - (81%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYE 91
            :||::||::|||:||:.|  |||::|||:::|||||||||||||||||:||:.||:|||.:|:..
 Frog    82 LTDEELVTMSVRELNQHL--RGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAEL 144

  Fly    92 WTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ..|:|::..:|..:|.|:.:.::||:||..||
 Frog   145 QQEVEKLASENASIRLELDSLRSKYEALQNFA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 29/50 (58%)
mafgXP_004916428.1 bZIP_Maf_small 104..173 CDD:269865 36/68 (53%)
coiled coil 104..173 CDD:269865 36/68 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.