DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafk

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_031748285.1 Gene:mafk / 100036635 XenbaseID:XB-GENE-959430 Length:173 Species:Xenopus tropicalis


Alignment Length:99 Identity:52/99 - (52%)
Similarity:77/99 - (77%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKS 89
            |.::||:|||:|||:||:.|  |||.:|||:|:|||||||||||||||||:||:.||:|||.::.
 Frog    39 PVLSDDELVSMSVRELNQHL--RGLTKEEIIRLKQRRRTLKNRGYAASCRVKRVTQKEELEKQRI 101

  Fly    90 YEWTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ....|::::..:|..::.|:...::||:||..||
 Frog   102 ELQQEVDKLARENSSMKLELDALRSKYEALQTFA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 34/68 (50%)
coiled coil 59..110 CDD:269865 26/50 (52%)
mafkXP_031748285.1 bZIP_Maf_small 63..132 CDD:269865 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6708
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1770
Inparanoid 1 1.050 108 1.000 Inparanoid score I4766
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm48877
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.