DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and SKI8

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_011302.1 Gene:SKI8 / 852659 SGDID:S000003181 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:517 Identity:95/517 - (18%)
Similarity:171/517 - (33%) Gaps:197/517 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 AISAETISLTSVNSTHLETLLVSIDGDEVMMIW------NTNTGAHAGKNYSKSKTAGKLNNVYW 485
            |..|:..|:::.||     ..||..||..:.:|      |.|.   ..|:||.......|::|  
Yeast    14 AHDADIFSVSACNS-----FTVSCSGDGYLKVWDNKLLDNENP---KDKSYSHFVHKSGLHHV-- 68

  Fly   486 LNNHVIVSLSRHQL---FFWSVEFERKMLRYKISKDKSHSCHLQDIVSFACDSSKEMIWLCRNNR 547
               .|:.::.|...   ...:..|...:|.|:|:::               |.:|::|:     .
Yeast    69 ---DVLQAIERDAFELCLVATTSFSGDLLFYRITRE---------------DETKKVIF-----E 110

  Fly   548 QIGMMNPKTGRMADFYGTVAFGVRAMAECPDDMNK-----IALGCS-DR----RVAFFDISKLTT 602
            ::.:::                        .||.|     :..|.| ||    |:...|: |.||
Yeast   111 KLDLLD------------------------SDMKKHSFWALKWGASNDRLLSHRLVATDV-KGTT 150

  Fly   603 SCLPIDSVYVSSNVYCLAWSPNCLEL-------------------------AFGTFDGTVGILDV 642
            ...........||...|.|||. |||                         |.|..:|||.|.::
Yeast   151 YIWKFHPFADESNSLTLNWSPT-LELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISEL 214

  Fly   643 ERMKVKTHLRTPHKKEVYSLVWQDHFIYFIVNRVLGFFDLRKSKIEPTIVNCISRPSYLSI-RDS 706
            ..::...:..:.|     |::...:             .:|..|..|       :.|.|:| .||
Yeast   215 STLRPLYNFESQH-----SMINNSN-------------SIRSVKFSP-------QGSLLAIAHDS 254

  Fly   707 FLFVGTDDGLLQIHERDSGMEKSWSPFIRQSALFARYVTDIAWCPLDSNKFAVSGNDRSVYVMEF 771
            ..|     |.:.::|.:.| |:..|..:                |..|::.::.....|.:||  
Yeast   255 NSF-----GCITLYETEFG-ERIGSLSV----------------PTHSSQASLGEFAHSSWVM-- 295

  Fly   772 QPTERNWKTLHTFTANTEKASITSMRWSHTQKHLLLTFHIEGKVCLWNCNAPEKPPLTITYHCPM 836
                       :.:.|....::.|..|             :||:..|:....|: ..|:..||. 
Yeast   296 -----------SLSFNDSGETLCSAGW-------------DGKLRFWDVKTKER-ITTLNMHCD- 334

  Fly   837 WCGMFLPTNENIIMCS--GKALSVE-LIDIKDALEG---------DEKSICPKVDALLNVKW 886
                .:...|:|:...  |.:|:.. :.|:|...:|         :|...|..:|.  :::|
Yeast   335 ----DIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSGMGADLNESLCCVCLDR--SIRW 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 78/431 (18%)
WD40 446..719 CDD:295369 60/317 (19%)
WD40 613..874 CDD:295369 54/298 (18%)
WD40 repeat 617..654 CDD:293791 13/61 (21%)
WD40 repeat 659..691 CDD:293791 4/31 (13%)
WD40 repeat 693..732 CDD:293791 10/39 (26%)
WD40 repeat 744..785 CDD:293791 5/40 (13%)
WD40 repeat 793..831 CDD:293791 7/37 (19%)
WD40 repeat 838..861 CDD:293791 4/25 (16%)
SKI8NP_011302.1 WD40 13..351 CDD:421866 87/474 (18%)
WD40 repeat 19..60 CDD:293791 13/48 (27%)
WD40 repeat 66..119 CDD:293791 10/101 (10%)
WD40 repeat 124..180 CDD:293791 18/57 (32%)
WD40 repeat 190..224 CDD:293791 6/33 (18%)
WD40 repeat 236..275 CDD:293791 14/51 (27%)
WD40 repeat 294..330 CDD:293791 10/62 (16%)
WD40 repeat 357..391 CDD:293791 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.