DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rig and RAD28

DIOPT Version :9

Sequence 1:	NP_611499.3	Gene:	rig / 37335	FlyBaseID:	FBgn0250850	Length:	1235	Species:	Drosophila melanogaster
Sequence 2:	NP_010313.3	Gene:	RAD28 / 851594	SGDID:	S000002437	Length:	506	Species:	Saccharomyces cerevisiae

Alignment Length:	136	Identity:	31/136 - (22%)
Similarity:	52/136 - (38%)	Gaps:	46/136 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    85 DDLSVQVWDCALGEAV----IGHKAHQHQHEARDVRVVHHTTNSVLMSYLANGNILSMDASDLVI 145
            :|.:|::||....|||    :|:|.:|                       .:.|:  :|.|.|::
Yeast   216 NDKTVKIWDTNRFEAVQDINLGYKINQ-----------------------IDNNV--VDDSSLLV 255

  Fly   146 YCVASNTYCRRSTFISPRNHQLTMV---------------RCSPYNDNLFAVGTAMGNVLVCDLR 195
              |||..|..|...:...|..:|.:               :.:|..:.:.|.|...|.|.:.|||
Yeast   256 --VASEDYYPRLIDLRTMNSGVTALGMGNQTRMQSEILCCKFNPVREQIIACGDMEGGVKLWDLR 318

  Fly   196 KMNIVY 201
            ..|.:|
Yeast   319 MRNRLY 324

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rig	NP_611499.3	WD40	<80..>215	CDD:295369	31/136 (23%)
		WD40	80..>215	CDD:225201	31/136 (23%)
		WD40 repeat	116..160	CDD:293791	9/43 (21%)
		WD40 repeat	167..204	CDD:293791	11/50 (22%)
		WD40	434..821	CDD:225201
		WD40	446..719	CDD:295369
		WD40	613..874	CDD:295369
		WD40 repeat	617..654	CDD:293791
		WD40 repeat	659..691	CDD:293791
		WD40 repeat	693..732	CDD:293791
		WD40 repeat	744..785	CDD:293791
		WD40 repeat	793..831	CDD:293791
		WD40 repeat	838..861	CDD:293791
RAD28	NP_010313.3	WD40	1..386	CDD:225201	31/136 (23%)
		WD40 repeat	61..102	CDD:293791
		WD40 repeat	108..170	CDD:293791
		WD40 repeat	198..233	CDD:293791	7/16 (44%)
		WD40 repeat	241..279	CDD:293791	12/64 (19%)
		WD40 repeat	290..351	CDD:293791	10/35 (29%)
		WD40 repeat	362..388	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4155
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900