DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and AT3G50390

DIOPT Version :10

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_190608.2 Gene:AT3G50390 / 824203 AraportID:AT3G50390 Length:469 Species:Arabidopsis thaliana


Alignment Length:258 Identity:52/258 - (20%)
Similarity:93/258 - (36%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VSLAAAAPDGGLLYAG-------------IRCINYISAPPANGEQPQVVTMSTRINILALDVSPM 68
            :|..|.:.|..|||:|             :||:..::|            ....:|.:   ||..
plant   214 ISCLALSEDKRLLYSGSWDKTFKVWRVSDLRCVESVNA------------HEDAVNAV---VSGF 263

  Fly    69 WGLGNGGPTKPFAIVGDDLSVQVWDCALGEAVIGHKAHQHQHEARDVRVVHHTTNSVLMSYLANG 133
            .||...|..        |.:|:||              :.:.:|:|.:   |..:..|:......
plant   264 DGLVFTGSA--------DGTVKVW--------------RREDQAKDTK---HFFSETLLKQDCAV 303

  Fly   134 NILSMDASDLVIYCVAS----NTYCRRSTFISP---RNHQLTMVRCSPYNDNLFAVGTA------ 185
            ..:::|.|..::||.:|    |.:.|.:...:.   :.|:|. |.|.....||...|:|      
plant   304 TAIAVDQSATLVYCGSSDGTVNFWERENNMKNGGVLKGHKLA-VLCLVAAGNLMFSGSADLGIRV 367

  Fly   186 -----MGNVLVCDLRKMNIVYKFHGHKAPI-CGLAWREVPAAEDEK-----TNNLALSAEEWR 237
                 .|...||    ::::   .||..|: |....|:..:...|:     :.:|..|.:.||
plant   368 WRRPEGGGEHVC----LSVL---TGHAGPVKCLAVERDQESVSGERRWIVYSGSLDRSVKMWR 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 repeat 116..160 CDD:293791 9/47 (19%)
WD40 repeat 167..204 CDD:293791 10/47 (21%)
WD40 446..719 CDD:475233
WD40 613..874 CDD:475233
WD40 repeat 617..654 CDD:293791
WD40 repeat 659..691 CDD:293791
WD40 repeat 693..732 CDD:293791
WD40 repeat 744..785 CDD:293791
WD40 repeat 793..831 CDD:293791
WD40 repeat 838..861 CDD:293791
AT3G50390NP_190608.2 WD40 98..423 CDD:238121 50/256 (20%)
WD40 repeat 101..134 CDD:293791
WD40 repeat 140..196 CDD:293791
WD40 repeat 214..250 CDD:293791 9/35 (26%)
WD40 repeat 257..292 CDD:293791 13/62 (21%)
WD40 repeat 303..340 CDD:293791 7/36 (19%)
WD40 repeat 348..384 CDD:293791 8/42 (19%)
WD40 repeat 390..422 CDD:293791 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.