DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and DCAF10

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_077321.3 Gene:DCAF10 / 79269 HGNCID:23686 Length:559 Species:Homo sapiens


Alignment Length:502 Identity:102/502 - (20%)
Similarity:157/502 - (31%) Gaps:154/502 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTPPGNVSLAAAAPDGGLLYAGIRCINYISA--------PPANGEQPQVVTMSTRINILALDVSP 67
            |..||..||:.|...|.|...|....:..||        ||.....|.....|...:.|      
Human    54 PRRPGAPSLSPAPRSGELGLPGAPESSTASAPGEPSPPSPPCRRPGPDCRAKSRGRHGL------ 112

  Fly    68 MWGLGNGGPTKPFAIVGDDLSVQVWDCALGEAVIGHKAHQHQHEARDVRVVHHTTNSVLMSYLAN 132
              |.|.|||       |..|...:.:.:||..:....|..:......:....|..:||.:|...:
Human   113 --GAGLGGP-------GARLFGWLKERSLGRGLFVDPARDNFRTMTSLYGSIHPADSVYLSTRTH 168

  Fly   133 GNILSM----DASDLVIYCVASNTYCRRSTFISP--RNHQLTM-------VRCSPYNDN-LFAVG 183
            |.:.::    |.|.|.:.|..:..     ....|  ..|..|:       |....:.|| |||..
Human   169 GAVFNLEYSPDGSVLTVACEQTEV-----LLFDPISSKHIKTLSEAHEDCVNNIRFLDNRLFATC 228

  Fly   184 TAMGNVLVCDLRKMNI-VYKFHGHKAPICGLAWREVPAAEDEKTNNLALSAEE-----WRSRNGG 242
            :....:.:.||||:|. |...|||.:.:..:.:       |..|..|..|..:     |.:....
Human   229 SDDTTIALWDLRKLNTKVCTLHGHTSWVKNIEY-------DTNTRLLVTSGFDGNVIIWDTNRYT 286

  Fly   243 QEEKPKTKPPPLTKSKAAESDDPFDIYNFDHLEYEFGAPIAERRRKSSEDCGGEFVGLEKPAGAA 307
            ::..|..|                    |.|..:..       |.:.:.||              
Human   287 EDGCPHKK--------------------FFHTRFLM-------RMRLTPDC-------------- 310

  Fly   308 VLDFVEACESVKAELLASRQEDKTQHVEVTLHDCEPTKPTGPLSDASTISNKNDASDSTEGSLEV 372
                        :::|.|......    :.|||.:.||                       ||||
Human   311 ------------SKMLISTSSGYL----LILHDLDLTK-----------------------SLEV 336

  Fly   373 IQY--------SSSSDDAVIVDGEAAKPKREVLHHI-YHQAEVHASGTPQTKS-EPQSNLQVV-P 426
            ..|        :||||..........:......||. .:.:|.|.|...|.:. .|:::|:|| |
Human   337 GSYPILRARRTTSSSDLTTSSSSSGPRVSGSPCHHSDSNSSEKHMSRASQREGVSPRNSLEVVTP 401

  Fly   427 AISAETISLTSVNSTHLE-----TLL---VSIDGDEVMMIWNTNTGA 465
            .:..|:.....:.|..|.     |||   .:.|.:|...::....||
Human   402 EVLGESDHGNCITSLQLHPKGWATLLRCSSNSDDEECTCVYEFQEGA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369 32/149 (21%)
WD40 80..>215 CDD:225201 32/149 (21%)
WD40 repeat 116..160 CDD:293791 9/47 (19%)
WD40 repeat 167..204 CDD:293791 13/45 (29%)
WD40 434..821 CDD:225201 9/40 (23%)
WD40 446..719 CDD:295369 6/23 (26%)
WD40 613..874 CDD:295369
WD40 repeat 617..654 CDD:293791
WD40 repeat 659..691 CDD:293791
WD40 repeat 693..732 CDD:293791
WD40 repeat 744..785 CDD:293791
WD40 repeat 793..831 CDD:293791
WD40 repeat 838..861 CDD:293791
DCAF10NP_077321.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 19/72 (26%)
WD40 <164..319 CDD:295369 38/219 (17%)
WD 1 166..205 7/43 (16%)
WD40 <171..>334 CDD:225201 41/254 (16%)
WD40 repeat 172..207 CDD:293791 7/39 (18%)
WD 2 209..247 11/37 (30%)
WD40 repeat 214..250 CDD:293791 12/35 (34%)
WD 3 251..290 7/45 (16%)
WD40 repeat 256..282 CDD:293791 5/32 (16%)
WD 4 296..335 12/98 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..396 10/45 (22%)
WD 5 408..448 7/39 (18%)
WD 6 470..508
WD40 517..555 CDD:197651
WD 7 526..559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.