DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and CG3909

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster


Alignment Length:346 Identity:75/346 - (21%)
Similarity:134/346 - (38%) Gaps:77/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 EFERKMLRYKISKDKSHSCHLQDIVSFACDSSKEMIWLCRNNRQIGMMNPKTGRMADFYGTVAFG 569
            :|::|..|   .||...:..|.|:|.         :|..:.:..:.:.:...|.        |.|
  Fly    43 DFDKKEAR---PKDFLVTGGLDDLVK---------VWDLQEDNTLKLRHKLKGH--------ALG 87

  Fly   570 VRAMAECPDDMNKIALGCSDRRVAFFDI----SKLTTSCLPIDSVYVSSNVYCLAWSPNCLELAF 630
            |.::|...|... ||....|..:..:|.    .|...|..|:|       ::.:.:||....:..
  Fly    88 VVSVAVSSDGQT-IASSSLDSTMCLWDARSGDKKHLLSFGPVD-------LWTVQFSPCNKYVIS 144

  Fly   631 GTFDGTVGILDVERMKVKTHLRTPHKKEVYSLVWQDHFIYF---IVNRVLGFFDLRKSKIEPTIV 692
            |..||.:.:..||..|.:..|...:.|...|:.:.....|.   .::.::..||:...|:..|:.
  Fly   145 GLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLE 209

  Fly   693 N--------CISRPSYLSIRDSFLFVGTDDGLLQIHERDSGMEKSWSPFIRQSALFARYVTDIAW 749
            .        |.|..|.|      |...:|||.::::      :.:.|..:...:..|.:|..:|:
  Fly   210 GHAMPVRSLCFSPNSQL------LLTASDDGHMKLY------DVTHSDVVGTLSGHASWVLCVAF 262

  Fly   750 CPLDSNKFAVSGNDRSVYVMEFQPTERNWKTLHTFTANTEKASITSMRWSHTQKHLLLTFHIEGK 814
            .. |...||.|.:|.||.:  :..:||  |.||||..:|::  :..:|:|.....:         
  Fly   263 SE-DGKHFASSSSDNSVKI--WDTSER--KCLHTFAEHTDQ--VWGVRYSPGNDKV--------- 311

  Fly   815 VCLWNCNAPEKPPLTITYHCP 835
                 .:|.|...|.| |:||
  Fly   312 -----ASASEDKSLNI-YYCP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 68/330 (21%)
WD40 446..719 CDD:295369 47/228 (21%)
WD40 613..874 CDD:295369 52/234 (22%)
WD40 repeat 617..654 CDD:293791 9/36 (25%)
WD40 repeat 659..691 CDD:293791 5/34 (15%)
WD40 repeat 693..732 CDD:293791 8/46 (17%)
WD40 repeat 744..785 CDD:293791 15/40 (38%)
WD40 repeat 793..831 CDD:293791 5/37 (14%)
WD40 repeat 838..861 CDD:293791
CG3909NP_649969.1 WD40 52..323 CDD:238121 69/329 (21%)
WD40 <54..326 CDD:225201 68/330 (21%)
WD40 repeat 89..127 CDD:293791 8/38 (21%)
WD40 repeat 130..166 CDD:293791 8/35 (23%)
WD40 repeat 174..209 CDD:293791 6/34 (18%)
WD40 repeat 215..251 CDD:293791 9/47 (19%)
WD40 repeat 257..293 CDD:293791 15/40 (38%)
WD40 repeat 299..323 CDD:293791 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.