DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and Wdsub1

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001014201.1 Gene:Wdsub1 / 362137 RGDID:1359296 Length:476 Species:Rattus norvegicus


Alignment Length:381 Identity:77/381 - (20%)
Similarity:121/381 - (31%) Gaps:121/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 ACESVKAELLASRQEDKT------------QHVEVTLH----DCEPTKPTGPLSDASTISNKNDA 362
            :|.:..:.|||:...|||            .|..:..|    .|....|:|.:.          |
  Rat    16 SCCAFSSTLLATCSLDKTIRLYSLSDFAELPHSPLKFHTYAVHCCSFSPSGHVL----------A 70

  Fly   363 SDSTEGSLEVIQYSSSSDDAVIVDGEAAKPKREVLHHIYHQAEVHASGTPQTKSEPQSNLQVVPA 427
            |.||:|: .|:..:.|.....:::.....|.|                                 
  Rat    71 SCSTDGT-TVLWSAHSGHTLTVLEQPGGSPVR--------------------------------- 101

  Fly   428 ISAETISLTSVNSTHLETLLVSIDGDEVMMIWNTNTGAHAGKNY-------------SKSKTAGK 479
                 :...|.:||:    |.|...|..:::||    ||:.|.|             :.|...|.
  Rat   102 -----VCCFSPDSTY----LASGAADGSVVLWN----AHSYKLYRCGSVKDSSLVACAFSPDGGL 153

  Fly   480 L-------NNVYWLNN-HVIVSLSRHQLFFWSVEFERKMLRYKISKDKSHSCHLQDIVSFACDSS 536
            |       :...|.:. ..:.|...|.|......|..:.|     ....|...|..:.|  |...
  Rat   154 LVTGSSGGDLTVWDDRMRCLHSEKAHDLGITCCSFSSQPL-----SGGEHGLQLYRLAS--CGQD 211

  Fly   537 KEM-IWLCRNNRQIGMMNPKTGRMADFYGTVAFGVRAMAEC--PDDMNKIALGCSDRRVAFFDIS 598
            .|: :|:....|.:|.       ...:..|::.....:..|  ..|...:|.|..|:.|..:||.
  Rat   212 CEIKLWVVSFTRVLGF-------ELKYRSTLSGHCAPVLACAFSHDGQMLASGSVDKSVIIYDIG 269

  Fly   599 KLTTSCLPIDSVYVSSNVYCLAWSPNCLELAFGTFDGTVGILDVERMKVKTHLRTP 654
              |.|.|...:.:......| |::||.|.||.|:.|.||.|...:       |.||
  Rat   270 --TQSVLHTLTQHTRYVTTC-AFAPNTLLLATGSMDKTVNIWQFD-------LETP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 56/245 (23%)
WD40 446..719 CDD:295369 53/233 (23%)
WD40 613..874 CDD:295369 15/42 (36%)
WD40 repeat 617..654 CDD:293791 13/36 (36%)
WD40 repeat 659..691 CDD:293791
WD40 repeat 693..732 CDD:293791
WD40 repeat 744..785 CDD:293791
WD40 repeat 793..831 CDD:293791
WD40 repeat 838..861 CDD:293791
Wdsub1NP_001014201.1 WD40 4..309 CDD:238121 74/366 (20%)
WD 1 10..47 7/30 (23%)
WD40 repeat 16..52 CDD:293791 8/35 (23%)
WD 2 52..91 11/49 (22%)
WD40 repeat 57..93 CDD:293791 10/46 (22%)
WD 3 95..134 14/84 (17%)
WD40 repeat 101..136 CDD:293791 13/80 (16%)
WD 4 137..176 4/38 (11%)
WD40 repeat 143..177 CDD:293791 5/33 (15%)
WD 5 178..228 12/63 (19%)
WD40 repeat 183..236 CDD:293791 11/66 (17%)
WD 6 237..276 11/40 (28%)
WD40 repeat 242..266 CDD:293791 6/23 (26%)
WD 7 279..318 15/45 (33%)
WD40 repeat 284..308 CDD:293791 11/24 (46%)
SAM_WDSUB1 328..399 CDD:188904
U-box 404..476 CDD:398320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.