DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and Dcaf10

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001101405.1 Gene:Dcaf10 / 313242 RGDID:1304730 Length:563 Species:Rattus norvegicus


Alignment Length:516 Identity:96/516 - (18%)
Similarity:159/516 - (30%) Gaps:189/516 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 GEAAKPKREVLHHIYHQAEVHASGTPQTKSEPQSNLQVVPAISAETISLTSVNSTHLETLLVSID 451
            ||.|.|:...|.....|||:..|.:|:.:|.|.                ....|...:.|...:.
  Rat    73 GELAAPEALELSAAASQAELSPSSSPRRRSRPD----------------CKAGSWSRQGLSAGLG 121

  Fly   452 GDEVMMI-W----NTNTGAHAGKNYSKSKTAGKLNNVYWLNNHVIVSLSRHQLFFWSVEFERKML 511
            |....:. |    :...|..........:|...|.......:.|.:|...|...| ::|:     
  Rat   122 GPGARLFGWLRERSLGRGLFVDPARDNFRTMTNLYGSIHPADSVYLSTRTHGAVF-NLEY----- 180

  Fly   512 RYKISKDKSHSCHLQDIVSFACDSSKEMIWLCRNNRQIGMMNPKTGRMADFYGTVAFGVRAMAEC 576
                |.|.|       :::.||:.::.:::...:::.|..::                 .|..:|
  Rat   181 ----SPDGS-------VLTVACEQTEVLLFDPISSKHIKTLS-----------------EAHEDC 217

  Fly   577 PDDM----NKIALGCS-DRRVAFFDISKLTTSCLPIDSVYVSSNVYCLAWSPNCLELAFGTFDGT 636
            .:::    |::...|| |..:|.:|:.||.|....:..  .:|.|..:.:..|...|....|||.
  Rat   218 VNNIRFLDNRLFATCSDDTTIALWDLRKLNTKVCTLHG--HTSWVKNIEYDTNTRLLVTSGFDGN 280

  Fly   637 VGILDVERMKVKTHLRTPHKKEVYSLVWQDHFIYFIVNRVLGFFDLR---KSKIEPTIVNCISRP 698
            |.|.|..|.   |....||||                     ||..|   :.::.|   :|    
  Rat   281 VIIWDTNRC---TEDGCPHKK---------------------FFHTRFLMRMRLTP---DC---- 314

  Fly   699 SYLSIRDSFLFVGTDDG-LLQIHERD--SGMEKSWSPFIRQSALFARYVTD-------------- 746
                   |.:.:.|..| ||.:|:.|  ..:|....|.:|     ||..|.              
  Rat   315 -------SKMLISTSSGYLLILHDLDLTKSLEVGSYPILR-----ARRTTSSSDLTTSSSSSGSR 367

  Fly   747 IAWCPL---DSNKF------------------------AVSG-NDRSVYVMEFQPTERNWKTLHT 783
            ::..|.   |||..                        .|.| .||...:...|...:.|.||..
  Rat   368 VSGSPCHHNDSNSTEKHVSRASQREGVSPRNSLEVLTPEVPGERDRGNCITSLQLHPKGWATLLR 432

  Fly   784 FTANTEKASITSMRWSHTQKHLLLTFHIEGKVCLWNC------NAPEKP-----PLTITYH 833
            .::||:...                         |.|      .||.:|     .|.:|::
  Rat   433 CSSNTDDQE-------------------------WTCVYEFQEGAPVRPVSPRCSLRLTHY 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 79/450 (18%)
WD40 446..719 CDD:295369 54/286 (19%)
WD40 613..874 CDD:295369 55/280 (20%)
WD40 repeat 617..654 CDD:293791 10/36 (28%)
WD40 repeat 659..691 CDD:293791 4/34 (12%)
WD40 repeat 693..732 CDD:293791 9/41 (22%)
WD40 repeat 744..785 CDD:293791 13/82 (16%)
WD40 repeat 793..831 CDD:293791 6/48 (13%)
WD40 repeat 838..861 CDD:293791
Dcaf10NP_001101405.1 WD40 <168..323 CDD:421866 44/228 (19%)
WD40 repeat 176..211 CDD:293791 8/51 (16%)
WD40 repeat 218..254 CDD:293791 9/35 (26%)
WD40 repeat 260..286 CDD:293791 8/25 (32%)
WD40 521..559 CDD:197651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.