DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig and WDSUB1

DIOPT Version :9

Sequence 1:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001121684.1 Gene:WDSUB1 / 151525 HGNCID:26697 Length:476 Species:Homo sapiens


Alignment Length:350 Identity:68/350 - (19%)
Similarity:118/350 - (33%) Gaps:96/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 HSC------HLQDIVSFACDSSKEMIWLCRNNRQIGMMNPKTGRMADFYGTVAFGVRAMAECPDD 579
            |.|      |:  :.|.:.|.: .::|...|.:.:.:|...:|.          .||.....||.
Human    58 HCCCFSPSGHI--LASCSTDGT-TVLWNTENGQMLAVMEQPSGS----------PVRVCQFSPDS 109

  Fly   580 MNKIALGCSDRRVAFFDI-SKLTTSCLPIDSVYVSSNVYCLAWSPNCLELAFGTFDGTVGILDVE 643
             ..:|.|.:|..|..::. |.....|   .||...|...| |:|||......|:..|.:.:.|  
Human   110 -TCLASGAADGTVVLWNAQSYKLYRC---GSVKDGSLAAC-AFSPNGSFFVTGSSCGDLTVWD-- 167

  Fly   644 RMKVKTHLRTPHKKEVYSL----------------------------------VWQDHFIYFIVN 674
                 ..:|..|.::.:.|                                  :|...|.:    
Human   168 -----DKMRCLHSEKAHDLGITCCDFSSQPVSDGEQGLQFFRLASCGQDCQVKIWIVSFTH---- 223

  Fly   675 RVLGFFDLRKSKIE----PTIVNCISRPSYLSIRDSFLFVGTDDGLLQIHERDSGMEKSWSPFIR 735
             :|||....||.:.    |.:....|....:      |..|:.|..:.::  |:..|.    .:.
Human   224 -ILGFELKYKSTLSGHCAPVLACAFSHDGQM------LVSGSVDKSVIVY--DTNTEN----ILH 275

  Fly   736 QSALFARYVTDIAWCPLDSNKFAVSGNDRSVYVMEFQ-----PTERNWKTLHTFTANTEKASITS 795
            ......||||..|:.| ::...|....|::|.:.:|.     ...|....|..||.:..:..:::
Human   276 TLTQHTRYVTTCAFAP-NTLLLATGSMDKTVNIWQFDLETLCQARRTEHQLKQFTEDWSEEDVST 339

  Fly   796 MRWSHTQKHLLLTF---HIEGKVCL 817
            ...:...|.|:..|   :|:||..|
Human   340 WLCAQDLKDLVGIFKMNNIDGKELL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 67/349 (19%)
WD40 446..719 CDD:295369 45/242 (19%)
WD40 613..874 CDD:295369 46/250 (18%)
WD40 repeat 617..654 CDD:293791 9/36 (25%)
WD40 repeat 659..691 CDD:293791 9/69 (13%)
WD40 repeat 693..732 CDD:293791 6/38 (16%)
WD40 repeat 744..785 CDD:293791 10/45 (22%)
WD40 repeat 793..831 CDD:293791 6/27 (22%)
WD40 repeat 838..861 CDD:293791
WDSUB1NP_001121684.1 WD40 <2..308 CDD:225201 56/292 (19%)
WD40 4..309 CDD:238121 56/293 (19%)
WD 1 10..47
WD40 repeat 16..52 CDD:293791
WD 2 52..91 7/35 (20%)
WD40 repeat 57..93 CDD:293791 7/37 (19%)
WD 3 95..134 10/49 (20%)
WD40 repeat 101..135 CDD:293791 9/37 (24%)
WD 4 137..176 12/46 (26%)
WD40 repeat 142..177 CDD:293791 10/42 (24%)
WD 5 178..228 5/54 (9%)
WD40 repeat 183..236 CDD:293791 7/57 (12%)
WD 6 237..276 7/50 (14%)
WD40 repeat 242..266 CDD:293791 4/29 (14%)
WD 7 279..318 10/39 (26%)
WD40 repeat 284..326 CDD:293791 9/42 (21%)
SAM_WDSUB1 328..399 CDD:188904 8/36 (22%)
SAM 332..395 CDD:197735 6/32 (19%)
U-box 404..476 CDD:252675
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.