DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11180 and TMA23

DIOPT Version :9

Sequence 1:NP_611495.1 Gene:CG11180 / 37330 FlyBaseID:FBgn0034528 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_013996.2 Gene:TMA23 / 855311 SGDID:S000004882 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:55/241 - (22%)
Similarity:83/241 - (34%) Gaps:98/241 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PKLKKKKKSKR-----------------------SSVDETEKTDNNCVEMAEITEESERTSSKKK 416
            |.|.|.|:.|:                       .::|.:..::|..::..:  .|:..|:..|.
Yeast    26 PILVKHKRDKKGLGNAPGGNDGEAWWERLFDGHLKNLDVSTDSNNGSIKFTQ--NEAVATAVSKS 88

  Fly   417 KS--------------------KKEEESAEVSIQTEESDQKKKRKSDKNKEIAEDSIEEPAAKKK 461
            .|                    ||||.|..||..:....:|::|:.:.:.::..        ||.
Yeast    89 SSPLYRWFVKGEGLKGTITNLGKKEEASFVVSSASSSKGKKRRRRDEDDNKVKR--------KKL 145

  Fly   462 KKSKKSDEVIVIDDDDLHRNNESHTSNENRTKNKSKSKDSQETTQIQEEITIDLTAEAPSKKKKK 526
            ||.||                   |||::.:|.|.|.|..:|                 |||.||
Yeast   146 KKDKK-------------------TSNDSESKKKKKKKSKKE-----------------SKKGKK 174

  Fly   527 SKEEKRKDNDEKDLEETPPASEATEKKSKKKSKLKSSAEPSTKLEI 572
            ||.    .:||.|     .:.....|||||..|.:|||....|..|
Yeast   175 SKH----SSDEGD-----KSKHKKSKKSKKHKKEESSARRDRKEHI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11180NP_611495.1 G-patch 27..70 CDD:279867
TMA23NP_013996.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2809
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.