DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11180 and SPAC1952.02

DIOPT Version :9

Sequence 1:NP_611495.1 Gene:CG11180 / 37330 FlyBaseID:FBgn0034528 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_594805.2 Gene:SPAC1952.02 / 2542568 PomBaseID:SPAC1952.02 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:246 Identity:55/246 - (22%)
Similarity:93/246 - (37%) Gaps:82/246 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EQPTAVEEIEQDAPKLKKKKKSK---GSSLDEIEQSENNFVEEKLVKSKERTSEQPTAVEEIEQD 373
            |:..|::|.....|.|..:|.:.   |:..|..:|..:|....:|...:..|.....||:.....
pombe    14 EEGNALKEGGLTKPILTSRKYNTHGLGAKHDIADQWWDNVFSAQLQSIQVNTDNGKVAVQSNGVS 78

  Fly   374 VPKLKKKKKSKRSSV----------------DETEKTDNNCV-----EMAEITEESERTSSKKKK 417
            ......|..||.|::                |..:|:.::.|     :..::.:.|.:.|||::|
pombe    79 TKLRMAKYHSKYSALSSVFRYAGRLCGTFEEDLVDKSLDSSVSPVSSKKVKVRKTSGKESSKREK 143

  Fly   418 SKKEEESAEVSIQTEESDQKKKRKSDKNKEIAEDSIEEPAAKKKKKSKKSDEVIVIDDDDLHRNN 482
            |||::|              ||.|.|               |.|||||:    :.:||       
pombe   144 SKKKKE--------------KKEKKD---------------KLKKKSKR----LKLDD------- 168

  Fly   483 ESHTSNENRTKNKSKSKDSQETTQIQEEITIDLTAEAPSKKKKKSKEEKRK 533
             |||   .:.|.|.:.|:|:::::              |..||.|..:|.|
pombe   169 -SHT---QKRKRKVRDKESKKSSK--------------SGLKKVSGTKKVK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11180NP_611495.1 G-patch 27..70 CDD:279867
SPAC1952.02NP_594805.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2809
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.