DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11180 and SPCC1442.13c

DIOPT Version :9

Sequence 1:NP_611495.1 Gene:CG11180 / 37330 FlyBaseID:FBgn0034528 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_588327.3 Gene:SPCC1442.13c / 2539327 PomBaseID:SPCC1442.13c Length:187 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:25/92 - (27%)
Similarity:38/92 - (41%) Gaps:28/92 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAEPRRRKKYNLCPRG----KALYEDE------------------------NRFGTKMLEKMGWT 40
            |::.|:.|...:.|:|    |.:...|                        |..|.::||.|||:
pombe    95 LSKKRKSKLVEMTPKGLKKRKRVQIQEGSVSTNTKKRMDGHVVGSSAPAINNGKGKQLLEMMGWS 159

  Fly    41 KGSGLGANLNGEKDFVRIRFKNDAEGL 67
            :|.|||:...|..|.|....||:.:||
pombe   160 RGKGLGSENQGMVDPVVAVVKNNKQGL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11180NP_611495.1 G-patch 27..70 CDD:279867 18/41 (44%)
SPCC1442.13cNP_588327.3 G_patch 145..186 CDD:197727 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.