DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and PAAF1

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001350485.1 Gene:PAAF1 / 80227 HGNCID:25687 Length:393 Species:Homo sapiens


Alignment Length:214 Identity:46/214 - (21%)
Similarity:80/214 - (37%) Gaps:59/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SIIDADFSPNGEHFAY-----STWSRSLFI--------------MPVNGGEDDCQWIDVNGL--- 218
            |.:|:.||...:.:.:     :.|..:.|.              |..|...:..:|:....:   
Human     7 SSVDSKFSTTMQAYVFPRCFGTAWVLTSFFPSYSDLDTVFITSNMIANFCCEPAEWVQTKSIHIS 71

  Fly   219 -PS-----------------HRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMP 265
             |.                 |..:|..|..|..|...:..|.:.|:.:.  :..|.::.|.....
Human    72 CPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGLGVSSSTDGTMKIW--QASNGELRRVLEGH 134

  Fly   266 GKDVNSVCFLHDKDPN--VIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGI--TYIDSR 326
            ..|||...|.    |:  |:::|..|..||::       |.:.:..|.:|.||..||  |.|..|
Human   135 VFDVNCCRFF----PSGLVVLSGGMDAQLKIW-------SAEDASCVVTFKGHKGGILDTAIVDR 188

  Fly   327 NDGYHVLSNSKDQSIKIWD 345
              |.:|:|.|:|.:.::||
Human   189 --GRNVVSASRDGTARLWD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 46/214 (21%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 46/214 (21%)
WD40 repeat 178..220 CDD:293791 8/64 (13%)
WD40 repeat 225..260 CDD:293791 7/34 (21%)
WD40 repeat 270..314 CDD:293791 10/45 (22%)
WD40 repeat 323..395 CDD:293791 9/23 (39%)
WD40 repeat 403..443 CDD:293791
PAAF1NP_001350485.1 WD40 90..339 CDD:330360 36/131 (27%)
WD40 repeat 96..133 CDD:293791 8/38 (21%)
WD40 repeat 139..175 CDD:293791 11/46 (24%)
WD40 repeat 180..223 CDD:293791 11/28 (39%)
WD40 repeat 232..279 CDD:293791
WD40 repeat 284..318 CDD:293791
WD40 repeat 326..359 CDD:293791
WD40 repeat 366..388 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.