| Sequence 1: | NP_611494.1 | Gene: | CG9945 / 37329 | FlyBaseID: | FBgn0034527 | Length: | 511 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_076962.2 | Gene: | NUP37 / 79023 | HGNCID: | 29929 | Length: | 326 | Species: | Homo sapiens |
| Alignment Length: | 254 | Identity: | 48/254 - (18%) |
|---|---|---|---|
| Similarity: | 90/254 - (35%) | Gaps: | 62/254 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 246 VIVTDIRTRNT-QILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKS 309
Fly 310 VASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQV------------ 362
Fly 363 ---------DPTTWDYRWNRVPREFYNPHK-PLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQR 417
Fly 418 YIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGS------WDTHV 470 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9945 | NP_611494.1 | WD40 | 128..467 | CDD:295369 | 45/249 (18%) |
| WD40 repeat | 131..170 | CDD:293791 | |||
| WD40 | <133..478 | CDD:225201 | 48/254 (19%) | ||
| WD40 repeat | 178..220 | CDD:293791 | |||
| WD40 repeat | 225..260 | CDD:293791 | 2/14 (14%) | ||
| WD40 repeat | 270..314 | CDD:293791 | 8/43 (19%) | ||
| WD40 repeat | 323..395 | CDD:293791 | 14/93 (15%) | ||
| WD40 repeat | 403..443 | CDD:293791 | 8/39 (21%) | ||
| NUP37 | NP_076962.2 | WD 1 | 6..54 | ||
| WD40 repeat | 22..70 | CDD:293791 | |||
| WD 2 | 61..109 | 0/2 (0%) | |||
| WD40 | <64..194 | CDD:421866 | 17/99 (17%) | ||
| WD40 repeat | 76..122 | CDD:293791 | 3/15 (20%) | ||
| WD 3 | 115..154 | 9/42 (21%) | |||
| WD40 repeat | 127..163 | CDD:293791 | 8/44 (18%) | ||
| WD 4 | 159..195 | 6/35 (17%) | |||
| WD40 repeat | 170..205 | CDD:293791 | 4/36 (11%) | ||
| WD 5 | 199..237 | 6/42 (14%) | |||
| WD40 repeat | 211..248 | CDD:293791 | 6/41 (15%) | ||
| WD 6 | 242..282 | 10/51 (20%) | |||
| WD 7 | 287..324 | 9/36 (25%) | |||
| WD40 repeat | 291..322 | CDD:293791 | 7/30 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||