Sequence 1: | NP_611494.1 | Gene: | CG9945 / 37329 | FlyBaseID: | FBgn0034527 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062627.3 | Gene: | Wsb1 / 78889 | MGIID: | 1926139 | Length: | 421 | Species: | Mus musculus |
Alignment Length: | 330 | Identity: | 61/330 - (18%) |
---|---|---|---|
Similarity: | 119/330 - (36%) | Gaps: | 117/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 WSIIDADFSPNGEHFAYSTWSRSLFIMP----------------------------VNGGEDDCQ 211
Fly 212 WIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGKDVNSVCFLH 276
Fly 277 DKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVL-SNSKDQS 340
Fly 341 IKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLR 405
Fly 406 AKFSPMEQTGQRYIYTGCATG---RIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGSWD 467
Fly 468 THVHL 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9945 | NP_611494.1 | WD40 | 128..467 | CDD:295369 | 58/323 (18%) |
WD40 repeat | 131..170 | CDD:293791 | |||
WD40 | <133..478 | CDD:225201 | 61/330 (18%) | ||
WD40 repeat | 178..220 | CDD:293791 | 12/69 (17%) | ||
WD40 repeat | 225..260 | CDD:293791 | 6/34 (18%) | ||
WD40 repeat | 270..314 | CDD:293791 | 8/43 (19%) | ||
WD40 repeat | 323..395 | CDD:293791 | 17/72 (24%) | ||
WD40 repeat | 403..443 | CDD:293791 | 2/42 (5%) | ||
Wsb1 | NP_062627.3 | WD 1 | 124..165 | 12/60 (20%) | |
WD40 | 135..388 | CDD:238121 | 37/202 (18%) | ||
WD40 | <139..382 | CDD:225201 | 37/198 (19%) | ||
WD 2 | 168..208 | 11/39 (28%) | |||
WD40 repeat | 174..212 | CDD:293791 | 10/37 (27%) | ||
WD 3 | 212..251 | 8/85 (9%) | |||
WD40 repeat | 217..253 | CDD:293791 | 6/77 (8%) | ||
WD 4 | 254..293 | 9/29 (31%) | |||
WD40 repeat | 261..299 | CDD:293791 | 7/22 (32%) | ||
WD 5 | 309..346 | ||||
WD40 repeat | 314..353 | CDD:293791 | |||
SOCS | 382..420 | CDD:295349 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |