Sequence 1: | NP_611494.1 | Gene: | CG9945 / 37329 | FlyBaseID: | FBgn0034527 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081467.2 | Gene: | Nup37 / 69736 | MGIID: | 1919964 | Length: | 326 | Species: | Mus musculus |
Alignment Length: | 230 | Identity: | 40/230 - (17%) |
---|---|---|---|
Similarity: | 86/230 - (37%) | Gaps: | 50/230 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 VIVTDIRTRNT-QILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKS 309
Fly 310 VASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQV------------ 362
Fly 363 -------DPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIY 420
Fly 421 TGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWH 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9945 | NP_611494.1 | WD40 | 128..467 | CDD:295369 | 40/230 (17%) |
WD40 repeat | 131..170 | CDD:293791 | |||
WD40 | <133..478 | CDD:225201 | 40/230 (17%) | ||
WD40 repeat | 178..220 | CDD:293791 | |||
WD40 repeat | 225..260 | CDD:293791 | 2/14 (14%) | ||
WD40 repeat | 270..314 | CDD:293791 | 9/43 (21%) | ||
WD40 repeat | 323..395 | CDD:293791 | 10/90 (11%) | ||
WD40 repeat | 403..443 | CDD:293791 | 8/39 (21%) | ||
Nup37 | NP_081467.2 | WD40 repeat | 22..70 | CDD:293791 | |
WD40 | <32..322 | CDD:225201 | 40/230 (17%) | ||
WD40 | <64..260 | CDD:295369 | 27/170 (16%) | ||
WD 1 | 70..117 | 2/10 (20%) | |||
WD40 repeat | 76..122 | CDD:293791 | 3/15 (20%) | ||
WD 2 | 122..162 | 10/51 (20%) | |||
WD40 repeat | 127..163 | CDD:293791 | 9/44 (20%) | ||
WD 3 | 164..203 | 5/38 (13%) | |||
WD40 repeat | 170..205 | CDD:293791 | 3/34 (9%) | ||
WD40 repeat | 211..248 | CDD:293791 | 5/40 (13%) | ||
WD40 repeat | 291..322 | CDD:293791 | 5/15 (33%) | ||
WD 4 | 294..325 | 5/12 (42%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |