DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and Wdr5b

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_081389.1 Gene:Wdr5b / 69544 MGIID:1916794 Length:328 Species:Mus musculus


Alignment Length:313 Identity:74/313 - (23%)
Similarity:134/313 - (42%) Gaps:62/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SIIDADFSPNGEHFAYSTWSRSLFIMPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGG 240
            :|....||||||..|.|.....:.|.....|  :|:    ..|..|.|.|..:.:|....:::..
Mouse    41 AISSVKFSPNGEWLASSAADALIIIWGAYDG--NCK----KTLYGHSLEISDVAWSSDSSRLVSA 99

  Fly   241 SNNSTVIVTDIRT-RNTQILRTHRMPGKDVNSVCFLHDKDP--NVIIAGCDDGLLKVYDLRTTFR 302
            |::.|:.|.|:|: :..:.|:.|       :...|..|.:|  |:|::|..|..:|:::::|   
Mouse   100 SDDKTLKVWDMRSGKCLKTLKGH-------SDFVFCCDFNPPSNLIVSGSFDESVKIWEVKT--- 154

  Fly   303 SRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWD------IRQPSNMRNRSRSRQQ 361
                .|.:.:...|.|.|:.::...:|..::|.|.|...:|||      :|..::..|...|..:
Mouse   155 ----GKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVK 215

  Fly   362 VDPT--------------TWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPME 412
            ..|.              .|||...|                .:.||.||:..|..|.|.||   
Mouse   216 FSPNGKYILTATLDNTLKLWDYSRGR----------------CLKTYTGHKNEKYCLFASFS--- 261

  Fly   413 QTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGS 465
            .||::::.:|.....:.|:::.|.:|.:.::||..|:.....||.::.|.|.:
Mouse   262 VTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 74/313 (24%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 74/313 (24%)
WD40 repeat 178..220 CDD:293791 12/41 (29%)
WD40 repeat 225..260 CDD:293791 7/35 (20%)
WD40 repeat 270..314 CDD:293791 10/45 (22%)
WD40 repeat 323..395 CDD:293791 16/91 (18%)
WD40 repeat 403..443 CDD:293791 10/39 (26%)
Wdr5bNP_081389.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
WD40 31..325 CDD:238121 74/313 (24%)
WD40 <34..325 CDD:225201 74/313 (24%)
WD 1 37..76 12/40 (30%)
WD40 repeat 42..79 CDD:293791 13/42 (31%)
WD 2 79..120 9/40 (23%)
WD40 repeat 85..121 CDD:293791 7/35 (20%)
WD 3 122..162 11/53 (21%)
WD40 repeat 126..162 CDD:293791 10/42 (24%)
WD 4 163..202 10/38 (26%)
WD40 repeat 169..204 CDD:293791 8/34 (24%)
DDB1-binding motif 186..190 1/3 (33%)
WD 5 206..247 8/56 (14%)
WD40 repeat 211..247 CDD:293791 7/51 (14%)
WD 6 250..290 11/42 (26%)
WD40 repeat 255..292 CDD:293791 10/39 (26%)
WD 7 293..328 7/22 (32%)
WD40 repeat 298..324 CDD:293791 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.