DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and WDR13

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001334146.1 Gene:WDR13 / 64743 HGNCID:14352 Length:485 Species:Homo sapiens


Alignment Length:498 Identity:88/498 - (17%)
Similarity:150/498 - (30%) Gaps:174/498 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WNLVHALQQRENGLASPHSASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKFNRSGSKLLTA 146
            |..|.|:..|.|...:|....|.....|..|.|...|.||....:|..:....:....|.:....
Human     5 WQQVLAVDARYNAYRTPTFPQFRTQYIRRRSQLLRENAKAGHPPALRRQYLRLRGQLLGQRYGPL 69

  Fly   147 CQDGFVRIYDGA--KGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFIMPVNGGEDD 209
            .:.|..|.|..:  :.:...|:|:.           ||                        |||
Human    70 SEPGSARAYSNSIVRSSRTTLDRME-----------DF------------------------EDD 99

  Fly   210 CQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGKDVNSVCF 274
            .:.:...|   ||.::....|                   .::.:..:.:...|.||    ||..
Human   100 PRALGARG---HRRSVSRGSY-------------------QLQAQMNRAVYEDRPPG----SVVP 138

  Fly   275 LHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHY--------DGITYIDSRNDGYH 331
            ....:.:..:|| |..|.:.|                :|.|.|        :.:..:...||..|
Human   139 TSAAEASRAMAG-DTSLSENY----------------AFAGMYHVFDQHVDEAVPRVRFANDDRH 186

  Fly   332 VLS-NSKDQSIKIWDI--RQPSNMR-NRSRSR----------------QQVDPT--TWDYRWNRV 374
            .|: .|.|.||.:..:  ..|:.:| .|..:|                ..:|.|  .|.....|.
Human   187 RLACCSLDGSISLCQLVPAPPTVLRVLRGHTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRC 251

  Fly   375 PREFYNP---------HKPLEGDSSIMTYRGHRV----TKTLLRAKFSPMEQTGQRYIYTGCATG 426
            .||..:|         .:|:..:.:::....|.|    ..|..:.|....:.||:....:..|.|
Human   252 IREIPDPDSAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFDAPG 316

  Fly   427 RII------------IYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGSWDTHVHLNNFSRSN 479
            |::            ::|:.|||:.:|   .|.|:.:            ||..|.:...::....
Human   317 RLLWAGDDRGSVFSFLFDMATGKLTKA---KRLVVHE------------GSPVTSISARSWVSRE 366

  Fly   480 ANRP------------------------VKRSHSSDHDKKPLR 498
            |..|                        :|||...:....|:|
Human   367 ARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 66/395 (17%)
WD40 repeat 131..170 CDD:293791 6/40 (15%)
WD40 <133..478 CDD:225201 67/401 (17%)
WD40 repeat 178..220 CDD:293791 6/41 (15%)
WD40 repeat 225..260 CDD:293791 1/34 (3%)
WD40 repeat 270..314 CDD:293791 7/43 (16%)
WD40 repeat 323..395 CDD:293791 20/102 (20%)
WD40 repeat 403..443 CDD:293791 11/51 (22%)
WDR13NP_001334146.1 WD 1 162..202 10/39 (26%)
WD40 175..481 CDD:421866 46/250 (18%)
WD 2 208..246 6/37 (16%)
WD40 repeat 221..258 CDD:293791 6/36 (17%)
WD 3 250..290 7/39 (18%)
WD40 repeat 263..300 CDD:293791 5/36 (14%)
WD 4 295..335 6/39 (15%)
WD40 repeat 308..347 CDD:293791 9/41 (22%)
WD 5 341..389 8/62 (13%)
WD40 repeat 354..400 CDD:293791 6/45 (13%)
WD 6 394..438 5/16 (31%)
WD40 repeat 408..450 CDD:293791 1/2 (50%)
WD 7 444..482
WD40 repeat 456..480 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.