DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and ambra1b

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001289149.1 Gene:ambra1b / 559106 ZFINID:ZDB-GENE-050208-235 Length:1360 Species:Danio rerio


Alignment Length:187 Identity:40/187 - (21%)
Similarity:75/187 - (40%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EDDCQWIDVNG----LPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGK 267
            ||..:|:....    ||.:..:.|.|.:||..:.:.....|..:.:||::|...    .|.:.|.
Zfish    33 EDRTRWMKWQSQKVELPDNPRSTFLLAFSPDRNLVASTHVNHNIYITDVKTGKC----LHSLVGH 93

  Fly   268 DVNSVCF-LHDKDPNVIIAGCDDGLLKVYDLRTTFRS--RDLSKSVASFIGHYDGITYIDSRNDG 329
            .....|. .|...|.::.:||.||.::::||.....|  .:.:.::||...|......:.:.|:.
Zfish    94 RRTPWCVTFHPTIPGLVASGCLDGEVRIWDLHGGSESWFTESNVAIASLAFHPTAQLLLIATNNE 158

  Fly   330 YH------------VLSNSKDQSIKI--WD---------IRQPSNMRNRSRSRQQVD 363
            .|            |.:.|:.:.:::  :|         |..|||.:|...|...:|
Zfish   159 LHFWDWSRPEPFAVVKTASETERVRLVRFDPLGHNLLTAIVNPSNQQNEDDSEVPMD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 40/187 (21%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 40/187 (21%)
WD40 repeat 178..220 CDD:293791 4/16 (25%)
WD40 repeat 225..260 CDD:293791 8/34 (24%)
WD40 repeat 270..314 CDD:293791 12/46 (26%)
WD40 repeat 323..395 CDD:293791 12/64 (19%)
WD40 repeat 403..443 CDD:293791
ambra1bNP_001289149.1 WD40 <43..>197 CDD:225201 30/157 (19%)
WD40 <58..197 CDD:295369 27/142 (19%)
WD40 repeat 58..91 CDD:293791 8/36 (22%)
WD40 repeat 98..134 CDD:293791 10/35 (29%)
WD40 repeat 139..175 CDD:293791 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.