DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and WSB2

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001265486.1 Gene:WSB2 / 55884 HGNCID:19222 Length:421 Species:Homo sapiens


Alignment Length:319 Identity:60/319 - (18%)
Similarity:118/319 - (36%) Gaps:108/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 WSIIDADFSPNGEHFAYSTWSRSLFIMPVNGGEDDCQWIDV---------------NGLPSHRL- 223
            ||:.   |||:|..||   ||:...|:.:.....:.|:|..               .|.|..:. 
Human    47 WSVA---FSPDGSWFA---WSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTL 105

  Fly   224 ----AIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGKDVNSVCFLHDKDPNVII 284
                .::.|.:||...                 ..:.::...|.....||:.:         |:.
Human   106 DCGQIVWGLAFSPWPS-----------------PPSRKLWARHHPQVPDVSCL---------VLA 144

  Fly   285 AGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVL-SNSKDQSIKIWDIRQ 348
            .|.:||.:|:::::|.....:||       ||.|.:..:.....|..:| |.|:|::::|||:  
Human   145 TGLNDGQIKIWEVQTGLLLLNLS-------GHQDVVRDLSFTPSGSLILVSASRDKTLRIWDL-- 200

  Fly   349 PSNMRNRSRSRQQV--DPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPM 411
                 |:...:.||  ....|.|..:..|            |.|::                  .
Human   201 -----NKHGKQIQVLSGHLQWVYCCSISP------------DCSML------------------C 230

  Fly   412 EQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGSWDTHV 470
            ...|::.::         ::.:.:..:...:|||::.:...|:.||.:.:|:.|:||:|
Human   231 SAAGEKSVF---------LWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 57/314 (18%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 60/319 (19%)
WD40 repeat 178..220 CDD:293791 12/56 (21%)
WD40 repeat 225..260 CDD:293791 3/34 (9%)
WD40 repeat 270..314 CDD:293791 8/43 (19%)
WD40 repeat 323..395 CDD:293791 16/74 (22%)
WD40 repeat 403..443 CDD:293791 1/39 (3%)
WSB2NP_001265486.1 WD40 repeat 46..106 CDD:293791 15/64 (23%)
WD40 47..384 CDD:225201 60/319 (19%)
WD40 138..377 CDD:238121 40/205 (20%)
WD40 repeat 174..212 CDD:293791 11/44 (25%)
WD40 repeat 217..253 CDD:293791 5/74 (7%)
WD40 repeat 261..306 CDD:293791 8/20 (40%)
WD40 repeat 313..345 CDD:293791
WD40 repeat 353..389 CDD:293791
SOCS_WSB_SWIP 381..419 CDD:239702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.