DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and wds

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:410 Identity:84/410 - (20%)
Similarity:167/410 - (40%) Gaps:104/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LVHALQQ------------RENGLASPHSASFSKNQQRYISNLYI-PNKKATRLMSLESK-IFVT 134
            :||..||            :.|.:..|.:.:.|.:.....|:|.: ||......::..:| :...
  Fly    14 VVHPPQQPLPTAPSGPNSLQPNSVGQPGATTSSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAV 78

  Fly   135 KFNRSGSKLLTACQDGFVRIYDGAKGTYHLL---NRIRARDVEWSIIDADFSPNGEHFAYSTWSR 196
            ||:.:|..|.::..|..::|:....|.:...   :::...||.|| .|:....:|..      .:
  Fly    79 KFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWS-SDSRLLVSGSD------DK 136

  Fly   197 SLFIMPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRT-RNTQILR 260
            :|.:..::.|:      .:..|..|...:|...::|..:.|:.||.:.:|.:.|:|| :..:.|.
  Fly   137 TLKVWELSTGK------SLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLP 195

  Fly   261 THRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDS 325
            .|..|   |::|.|  ::|.::|::...|||.:::|   |...:.|.             |.||.
  Fly   196 AHSDP---VSAVHF--NRDGSLIVSSSYDGLCRIWD---TASGQCLK-------------TLIDD 239

  Fly   326 RN----------DGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREFYN 380
            .|          :|.::|:.:.|.::|:||                                 |:
  Fly   240 DNPPVSFVKFSPNGKYILAATLDNTLKLWD---------------------------------YS 271

  Fly   381 PHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGH 445
            ..|.|:      ||.||:..|..:.|.||   .||.::|.:|.....:.|:::.:.::.:.::||
  Fly   272 KGKCLK------TYTGHKNEKYCIFANFS---VTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGH 327

  Fly   446 RTVIRDLDWHPDRSEIVSGS 465
            ...:.....||..:.|.|.:
  Fly   328 TDTVLCTACHPTENIIASAA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 73/353 (21%)
WD40 repeat 131..170 CDD:293791 7/41 (17%)
WD40 <133..478 CDD:225201 72/347 (21%)
WD40 repeat 178..220 CDD:293791 5/41 (12%)
WD40 repeat 225..260 CDD:293791 9/35 (26%)
WD40 repeat 270..314 CDD:293791 10/43 (23%)
WD40 repeat 323..395 CDD:293791 13/81 (16%)
WD40 repeat 403..443 CDD:293791 8/39 (21%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 73/360 (20%)
WD40 repeat 75..112 CDD:293791 7/36 (19%)
WD40 repeat 118..154 CDD:293791 9/48 (19%)
WD40 repeat 159..195 CDD:293791 9/35 (26%)
WD40 repeat 202..237 CDD:293791 11/52 (21%)
WD40 repeat 244..280 CDD:293791 10/74 (14%)
WD40 repeat 288..325 CDD:293791 8/39 (21%)
WD40 repeat 331..357 CDD:293791 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.