DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and Nup37

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001262950.1 Gene:Nup37 / 43040 FlyBaseID:FBgn0039301 Length:320 Species:Drosophila melanogaster


Alignment Length:241 Identity:47/241 - (19%)
Similarity:80/241 - (33%) Gaps:82/241 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KDVNSVCFLHDKD-----PNVIIAGCDDGLLKVYDLRTTFRSRDLSK--SVASFIGHYDGITYID 324
            :.|:::.|..|..     .||.:...:...||:|  ||     ||.:  |:....||.|.:..:.
  Fly    70 RSVSALAFSPDTSLNCTPNNVTLCAANGSQLKLY--RT-----DLGQFTSLQVLRGHGDYVNDVS 127

  Fly   325 SRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDS 389
            ...||..:.|.|.|.:.:.|                    ||                  ..|..
  Fly   128 WVCDGELLASVSDDFTCRFW--------------------TT------------------TGGGE 154

  Fly   390 SIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDW 454
            :::|:   .::...:..|..|.:   ...:......|.|.:|:|...:...::|..:..:...||
  Fly   155 NVITF---GLSSAGMSVKSHPED---PNKVLVAEKKGIIHLYNVTLKQTVISVESPKFPLMSADW 213

  Fly   455 -HPDRSEIVS------GSWDTHVHLNNFSRSNANRP-----VKRSH 488
             |.:|..|.|      .:||            .|||     ||:.|
  Fly   214 AHSNRLFITSLAGGDVVTWD------------LNRPYVPADVKQVH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 39/213 (18%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 41/224 (18%)
WD40 repeat 178..220 CDD:293791
WD40 repeat 225..260 CDD:293791
WD40 repeat 270..314 CDD:293791 12/50 (24%)
WD40 repeat 323..395 CDD:293791 10/71 (14%)
WD40 repeat 403..443 CDD:293791 6/39 (15%)
Nup37NP_001262950.1 WD40 71..320 CDD:295369 47/240 (20%)
WD40 <71..318 CDD:225201 47/240 (20%)
WD40 repeat 72..118 CDD:293791 13/52 (25%)
WD40 repeat 124..160 CDD:293791 10/76 (13%)
WD40 repeat 165..202 CDD:293791 6/39 (15%)
WD40 repeat 209..245 CDD:293791 12/47 (26%)
WD40 repeat 252..286 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.