| Sequence 1: | NP_611494.1 | Gene: | CG9945 / 37329 | FlyBaseID: | FBgn0034527 | Length: | 511 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263303.1 | Gene: | WDR38 / 401551 | HGNCID: | 23745 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 230 | Identity: | 54/230 - (23%) |
|---|---|---|---|
| Similarity: | 94/230 - (40%) | Gaps: | 58/230 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 243 NSTVIVTDIRTRNTQILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLS 307
Fly 308 KSVASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWN 372
Fly 373 RVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGK 437
Fly 438 IQEAIEGHRTVIRDLDWHPDRSEIVSGSWDTHVHL 472 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9945 | NP_611494.1 | WD40 | 128..467 | CDD:295369 | 50/223 (22%) |
| WD40 repeat | 131..170 | CDD:293791 | |||
| WD40 | <133..478 | CDD:225201 | 54/230 (23%) | ||
| WD40 repeat | 178..220 | CDD:293791 | |||
| WD40 repeat | 225..260 | CDD:293791 | 5/16 (31%) | ||
| WD40 repeat | 270..314 | CDD:293791 | 13/43 (30%) | ||
| WD40 repeat | 323..395 | CDD:293791 | 8/71 (11%) | ||
| WD40 repeat | 403..443 | CDD:293791 | 9/39 (23%) | ||
| WDR38 | NP_001263303.1 | WD40 | <11..299 | CDD:225201 | 50/220 (23%) |
| WD 1 | 19..58 | 16/47 (34%) | |||
| WD40 | 20..301 | CDD:238121 | 49/211 (23%) | ||
| WD40 repeat | 26..61 | CDD:293791 | 12/43 (28%) | ||
| WD 2 | 61..100 | 10/77 (13%) | |||
| WD40 repeat | 67..103 | CDD:293791 | 8/74 (11%) | ||
| WD 3 | 103..142 | 11/44 (25%) | |||
| WD40 repeat | 108..144 | CDD:293791 | 9/39 (23%) | ||
| WD 4 | 145..184 | 12/29 (41%) | |||
| WD40 repeat | 151..189 | CDD:293791 | 8/23 (35%) | ||
| WD 5 | 190..228 | ||||
| WD40 repeat | 195..230 | CDD:293791 | |||
| WD 6 | 231..272 | ||||
| WD40 repeat | 236..272 | CDD:293791 | |||
| WD 7 | 275..313 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 295..315 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||