DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and CG10064

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster


Alignment Length:459 Identity:84/459 - (18%)
Similarity:143/459 - (31%) Gaps:139/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFDSSDNELGFNVINFTVNAMDLRSDYCSSEMPVIR--------GKPDLVKFQKTDMYKEIQASS 72
            |.:..:......:|||        .||.....|.:|        |:.......||||:.....::
  Fly   291 DIELVEERTDVPLINF--------RDYPGPTWPYLRTLKKTHVSGRISSFVRSKTDMFYICTDTN 347

  Fly    73 GLVSNPNNRW--NLVHALQQRENGLASPHSASFSKNQQRYISNLYIPNKKATRLMSLESK----- 130
            .:.......|  .|:.....:     |.:..:|.||   |........|:..|:.|...|     
  Fly   348 EIYGLNIKTWVLKLLRTCHTK-----SVYCITFPKN---YSGVFATSGKECIRIWSSGRKQELLR 404

  Fly   131 IFVTKFN-------RSGSKLLTACQDGFVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEH 188
            |.|..||       ..|:.:::...||.:|.:....|                            
  Fly   405 IMVYNFNCACVRFTHDGTSIVSVWNDGIIRAFTPITG---------------------------- 441

  Fly   189 FAYSTWSRSLFIMPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDI-- 251
                   |.::.:|                .:|.....:|..:.:|..|:.|.....|.|..|  
  Fly   442 -------RLIYAIP----------------NAHNKGCSALAVASSGRLIVTGGIEGQVRVWKIDP 483

  Fly   252 -RTRNTQILRTHRMP--GKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASF 313
             |.....:|:.|..|  ..|:|.:    |.:   :|:.|.||...::|::...|.:.::.:....
  Fly   484 YRQDLVGVLKDHSGPITSLDINYL----DTE---VISACTDGSCVIWDIKRMTRKQVVTANTQFM 541

  Fly   314 IGHY--DGITYIDSRNDG---YHVLSN---------SKDQSIKIWDIRQPSNMRNRSRSRQQVDP 364
            ...|  .|:..|...:||   |.::.|         ||..|:....|.:..:......|..||  
  Fly   542 SASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQV-- 604

  Fly   365 TTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRII 429
            ..|||                  :|..:...|.....:::...:||.    .....||...|.:|
  Fly   605 KLWDY------------------NSGAVVGIGSEHASSVISCAYSPC----MTMFVTGSTDGSLI 647

  Fly   430 IYDV 433
            |:||
  Fly   648 IWDV 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 61/337 (18%)
WD40 repeat 131..170 CDD:293791 9/45 (20%)
WD40 <133..478 CDD:225201 59/327 (18%)
WD40 repeat 178..220 CDD:293791 2/41 (5%)
WD40 repeat 225..260 CDD:293791 8/37 (22%)
WD40 repeat 270..314 CDD:293791 8/43 (19%)
WD40 repeat 323..395 CDD:293791 16/83 (19%)
WD40 repeat 403..443 CDD:293791 9/31 (29%)
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 31/158 (20%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 84/459 (18%)
WD40 366..650 CDD:238121 67/373 (18%)
WD40 repeat 370..407 CDD:293791 9/39 (23%)
WD40 repeat 412..449 CDD:293791 7/87 (8%)
WD40 repeat 456..494 CDD:293791 9/37 (24%)
WD40 repeat 499..535 CDD:293791 9/42 (21%)
WD40 repeat 541..576 CDD:293791 7/34 (21%)
WD40 repeat 583..617 CDD:293791 8/53 (15%)
WD40 repeat 625..651 CDD:293791 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.