DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and Wdr38

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_575125.6 Gene:Wdr38 / 366035 RGDID:1562587 Length:299 Species:Rattus norvegicus


Alignment Length:378 Identity:79/378 - (20%)
Similarity:137/378 - (36%) Gaps:119/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ASFSKNQQRYISN-----LYIPNKKATRLM----SLESKIFVTKFNRSGSKLLTACQDGFVRIYD 156
            ::||.:.:..|:.     :|:...|:.||:    ..:..:...:|:..|..:.::..|..:|::|
  Rat    27 SAFSPDGRNLITASDDGCVYVWGTKSGRLLWRLAGHKGPVKSCRFSPDGRLVASSSCDHTIRLWD 91

  Fly   157 GAKG-TYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFIMPVNGGEDDCQWIDVNGLPS 220
            .||. ..|:| :...|.||    ...|||:.:..|...|.:.:.:..|..|.      :|..||.
  Rat    92 VAKAKCLHVL-KGHQRSVE----TVSFSPDSKQLASGGWDKRVILWEVQSGR------NVRFLPG 145

  Fly   221 HRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGKDVNSVCFLHDKDPNVIIA 285
            |..:|.|..:|||.|.:..||.:|||.:.|:|..:..:                           
  Rat   146 HCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASSPAV--------------------------- 183

  Fly   286 GCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPS 350
                          :||:.:         ||...|:.:.....|. :.|.|.|::::||      
  Rat   184 --------------SFRNLE---------GHTGNISCLKYSASGL-LASGSWDKTVRIW------ 218

  Fly   351 NMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTG 415
                        .|||                     ::.::..|||......|  .|||.|.. 
  Rat   219 ------------KPTT---------------------NNLLLQLRGHATWVNSL--AFSPDELK- 247

  Fly   416 QRYIYTGCATGRII-IYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGSWD 467
                .......|:: ::|.||||..|.::|...|.....:.|:...:|||..|
  Rat   248 ----LASAGYSRMVKVWDCLTGKCLETLKGMLDVAHACIFTPNGKLLVSGIAD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 71/340 (21%)
WD40 repeat 131..170 CDD:293791 9/39 (23%)
WD40 <133..478 CDD:225201 72/337 (21%)
WD40 repeat 178..220 CDD:293791 9/41 (22%)
WD40 repeat 225..260 CDD:293791 13/34 (38%)
WD40 repeat 270..314 CDD:293791 2/43 (5%)
WD40 repeat 323..395 CDD:293791 9/71 (13%)
WD40 repeat 403..443 CDD:293791 12/40 (30%)
Wdr38XP_575125.6 WD40 <13..298 CDD:225201 79/378 (21%)
WD40 20..298 CDD:238121 79/378 (21%)
WD40 repeat 26..61 CDD:293791 7/33 (21%)
WD40 repeat 67..103 CDD:293791 9/36 (25%)
WD40 repeat 108..144 CDD:293791 10/45 (22%)
WD40 repeat 151..189 CDD:293791 14/78 (18%)
WD40 repeat 195..230 CDD:293791 10/74 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.