DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and Nup37

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001100245.1 Gene:Nup37 / 299706 RGDID:1307774 Length:326 Species:Rattus norvegicus


Alignment Length:230 Identity:40/230 - (17%)
Similarity:86/230 - (37%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VIVTDIRTRNT-QILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKS 309
            :..:|::.:|. ::|..|   ...:|.:.| |.::...|.:..||...:::.|.        .|.
  Rat   106 LFTSDLQDKNEYKVLEGH---SDFINDLVF-HPREGQEIASVSDDHTCRIWSLE--------GKQ 158

  Fly   310 VASFIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQV------------ 362
            .|.|:.|..|::......:.:.::...|:.:|:.:|:.....:.:....:..:            
  Rat   159 TAHFLLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLMAQQAILSLQSEQTPLMSAHWCLKNTFK 223

  Fly   363 -------DPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIY 420
                   |...||...:..|:|    .:|:..|.: .::|...:::.|...       ||    |
  Rat   224 VGAVAGNDWIIWDITRSSYPQE----TRPVHMDRA-HSFRWSAISENLFAT-------TG----Y 272

  Fly   421 TGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWH 455
            .|..:.:..|:.:  |..|..:.|...|...|.||
  Rat   273 PGKMSSQFQIHHL--GHSQPILIGSVPVGSGLSWH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 40/230 (17%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 40/230 (17%)
WD40 repeat 178..220 CDD:293791
WD40 repeat 225..260 CDD:293791 2/14 (14%)
WD40 repeat 270..314 CDD:293791 9/43 (21%)
WD40 repeat 323..395 CDD:293791 10/90 (11%)
WD40 repeat 403..443 CDD:293791 8/39 (21%)
Nup37NP_001100245.1 WD40 repeat 22..70 CDD:293791
WD40 <64..260 CDD:421866 27/170 (16%)
WD40 repeat 76..122 CDD:293791 3/15 (20%)
WD40 repeat 127..163 CDD:293791 9/44 (20%)
WD40 repeat 170..205 CDD:293791 3/34 (9%)
WD40 repeat 211..248 CDD:293791 5/40 (13%)
WD40 repeat 291..322 CDD:293791 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.