DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and WDR27

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_872358.4 Gene:WDR27 / 253769 HGNCID:21248 Length:895 Species:Homo sapiens


Alignment Length:449 Identity:85/449 - (18%)
Similarity:155/449 - (34%) Gaps:131/449 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GLASPHSASFSKNQQRYISNLYIPNKKATRLMSLESKI---------FVTKFN---------RSG 140
            |:|...|...:..|:|...|:    .|..||: ..||:         .||.|:         :..
Human   452 GIAKEKSTKAASEQRRAARNV----MKDQRLV-FHSKVRSSGYASAPHVTMFSPKTNIKSEGKGS 511

  Fly   141 SKLLTACQDGFVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFIMPVNG 205
            |:..::|          |:..|         .||.::   ...|..:..|..|.:|...|.....
Human   512 SRSRSSC----------AREAY---------PVECAV---PTKPGPQVAAAPTCTRVCCIQYSGD 554

  Fly   206 GEDDCQWIDVNGLPSHRLAIF--SLRYSP---------------TGDK--IIGGSNNSTVIVTDI 251
            |    ||: ..||.:|.|.:|  ||..:|               :.|:  ::..:.:.|:.:...
Human   555 G----QWL-ACGLANHLLLVFDASLTGTPAVFSGHDGAVNAVCWSQDRRWLLSAARDGTLRMWSA 614

  Fly   252 RTRNTQILRTHRMPGKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRT------TFRSRDLSKSV 310
            |.....:|....|..|.:.|..|.: .|..::::...:..|..|.:.|      .::.:..||.:
Human   615 RGAELALLLGKDMFSKPIQSAQFYY-IDAFILLSSGPEFQLLRYHIDTCKDEIKRYKQKSKSKLI 678

  Fly   311 A--SFIGHYDGITYIDSRNDGYH--VLSNSKDQSIKIWDIR-------------QPSNM--RNRS 356
            .  |..|..| :|.:.:.||.|.  ||:..::::::::|:.             :|.:.  :|:.
Human   679 CRLSTTGAVD-MTSLSAVNDFYSHIVLAAGRNRTVEVFDLNAGCSAAVIAEAHSRPVHQICQNKG 742

  Fly   357 RSRQQVDP-------TT--------WDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRA 406
            .|.....|       ||        ||.|..|..|.|                .||.........
Human   743 SSFTTQQPQAYNLFLTTAIGDGMRLWDLRTLRCERHF----------------EGHPTRGYPCGI 791

  Fly   407 KFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGS 465
            .|||.    .|:...|.......:|::.:......:.||...:..:.::|...::.|.|
Human   792 AFSPC----GRFAACGAEDRHAYVYEMGSSTFSHRLAGHTDTVTGVAFNPSAPQMESRS 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 76/415 (18%)
WD40 repeat 131..170 CDD:293791 7/56 (13%)
WD40 <133..478 CDD:225201 74/401 (18%)
WD40 repeat 178..220 CDD:293791 10/41 (24%)
WD40 repeat 225..260 CDD:293791 7/53 (13%)
WD40 repeat 270..314 CDD:293791 9/51 (18%)
WD40 repeat 323..395 CDD:293791 18/103 (17%)
WD40 repeat 403..443 CDD:293791 6/39 (15%)
WDR27NP_872358.4 WD40 15..356 CDD:225201
WD40 repeat 32..69 CDD:293791
WD40 <48..266 CDD:295369
WD40 repeat 74..119 CDD:293791
WD40 repeat 127..161 CDD:293791
WD40 repeat 197..230 CDD:293791
WD40 repeat 241..267 CDD:293791
WD40 <544..865 CDD:225201 62/330 (19%)
WD40 545..842 CDD:295369 60/323 (19%)
WD40 repeat 546..583 CDD:293791 12/41 (29%)
WD40 repeat 589..660 CDD:293791 11/71 (15%)
WD40 repeat 678..727 CDD:293791 10/49 (20%)
WD40 repeat 735..780 CDD:293791 11/60 (18%)
WD40 repeat 788..824 CDD:293791 6/39 (15%)
GVQW 847..>881 CDD:290611 85/449 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.