DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and WDR90

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_016878512.1 Gene:WDR90 / 197335 HGNCID:26960 Length:1838 Species:Homo sapiens


Alignment Length:298 Identity:65/298 - (21%)
Similarity:119/298 - (39%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WNLVHALQQRENGLAS---PHSASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKF--NRSGS 141
            |:|. .|||..:..:|   |.:.:|...:..:....   :..|.|..|||:...:.:.  :|...
Human   728 WDLA-TLQQLYDFTSSEDAPCAVTFHPTRPTFFCGF---SSGAVRSFSLEAAEVLVEHTCHRGAV 788

  Fly   142 KLLTACQDGFVRIYDGAKGTYHLLNRIRARDVEWSII---------DADFSP-------NGEHFA 190
            ..|||..||.:.....::|:   |.:....|.:|.::         ||..||       :|...|
Human   789 TGLTATPDGRLLFSSCSQGS---LAQYSCADPQWHVLRVAADMVCPDAPASPSALAVSRDGRLLA 850

  Fly   191 YSTWSRSLFIMPVNGGEDDCQWIDVN--GLPSHRL-AIFSLRYSPT--GDKIIGGSNNSTVIVTD 250
            :...||....:..:...|:...:|:.  .|.|.|| :..::.:.|.  |..::..|:|..|::..
Human   851 FVGPSRCTVTVMGSASLDELLRVDIGTLDLASSRLDSAMAVCFGPAALGHLLVSTSSNRVVVLDA 915

  Fly   251 IRTRNTQILRTHRMPG---KDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVAS 312
            :..|..:.....::||   :...|:....|....:|.||   ..:||:|..|     ..|.....
Human   916 VSGRIIRESTVFQLPGVHPEPCPSLTLSEDARFLLIAAG---RTIKVWDYAT-----QASPGPQV 972

  Fly   313 FIGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPS 350
            :|||.:.:..:....|...||  |...::.:||:..|:
Human   973 YIGHSEPVQAVAFSPDQQQVL--SAGDAVFLWDVLAPT 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 53/249 (21%)
WD40 repeat 131..170 CDD:293791 8/40 (20%)
WD40 <133..478 CDD:225201 52/244 (21%)
WD40 repeat 178..220 CDD:293791 11/59 (19%)
WD40 repeat 225..260 CDD:293791 6/36 (17%)
WD40 repeat 270..314 CDD:293791 10/43 (23%)
WD40 repeat 323..395 CDD:293791 7/28 (25%)
WD40 repeat 403..443 CDD:293791
WDR90XP_016878512.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.