DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9945 and WDR49

DIOPT Version :9

Sequence 1:NP_611494.1 Gene:CG9945 / 37329 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001353086.1 Gene:WDR49 / 151790 HGNCID:26587 Length:1049 Species:Homo sapiens


Alignment Length:504 Identity:94/504 - (18%)
Similarity:167/504 - (33%) Gaps:164/504 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KFQKTDMYKEIQASSGL-------VSNPNN-----------RWNL--------VHALQQRENGLA 96
            |..:.|..:::..::.|       .||.|:           |.|:        :||...      
Human   310 KLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREKSKKRLNMTSFNIAQGIHAFDY------ 368

  Fly    97 SPHS-----ASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKFNRSGSKLLTACQDGFVRIYD 156
              ||     |:...|.:..:.|.|:.:|....|....:.:...:|.....:|.:..:|..:|::|
Human   369 --HSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWD 431

  Fly   157 GAKGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYSTWSRSLFIMPVNGGEDDCQWIDVNG---- 217
                ..|.|:..|        |...| |..:.|      |.||......|.   .:|..|.    
Human   432 ----IQHQLSIQR--------IACSF-PKSQDF------RCLFHFDEAHGR---LFISFNNQLAL 474

  Fly   218 ----------LPSHRLAIFSLRYSPTGDKIIGGSNNSTVI--VTDIRTRNTQILRTHRMPGKDVN 270
                      :.||..|:..:.|:....::|.....|||.  :.|...:..|....|  ...:::
Human   475 LAMKSEASKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCH--GNAEIS 537

  Fly   271 SVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGY--HVL 333
            ::..  |.:...::.|..||.:|::|.                              :||  |.|
Human   538 TMAL--DANETRLLTGSTDGTVKIWDF------------------------------NGYCHHTL 570

  Fly   334 SNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTW---DY-RWNRVPREF--YNPH-------KPL 385
            :..:|.::   ||.|...:      ::::..|.|   || .|..:.|..  :.|.       :|.
Human   571 NVGQDGAV---DISQILIL------KKKILVTGWERYDYASWKTIGRAITVFRPQNFNQFFIQPE 626

  Fly   386 EGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVIR 450
            |....|..:      ..:|.|.|.| .||    :.||...|.|::::..|......:        
Human   627 EWKGGIQHH------DDILCAAFLP-PQT----LVTGSYDGEIVLWNNSTENAHHVL-------- 672

  Fly   451 DLDWHPDRSEIVSGSWDTHVH-LNNFSRSNANRPVKRSHSSDHDKKPLR 498
                |||...::....||... |.:..||..:.|:     :||....:|
Human   673 ----HPDYQRLLKSKLDTKPQKLLSAGRSQPSHPM-----ADHSTTGVR 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 67/369 (18%)
WD40 repeat 131..170 CDD:293791 7/38 (18%)
WD40 <133..478 CDD:225201 70/376 (19%)
WD40 repeat 178..220 CDD:293791 10/55 (18%)
WD40 repeat 225..260 CDD:293791 7/36 (19%)
WD40 repeat 270..314 CDD:293791 6/43 (14%)
WD40 repeat 323..395 CDD:293791 18/86 (21%)
WD40 repeat 403..443 CDD:293791 11/39 (28%)
WDR49NP_001353086.1 WD40 repeat 143..186 CDD:293791
WD40 repeat 192..231 CDD:293791
WD40 repeat 236..308 CDD:293791
WD40 259..561 CDD:330360 52/284 (18%)
WD40 repeat 318..356 CDD:293791 6/37 (16%)
WD40 repeat 363..400 CDD:293791 9/44 (20%)
WD40 repeat 406..432 CDD:293791 5/29 (17%)
WD40 482..853 CDD:330360 58/302 (19%)
WD40 repeat 493..529 CDD:293791 7/35 (20%)
WD40 repeat 536..571 CDD:293791 9/66 (14%)
WD40 repeat 580..625 CDD:293791 9/50 (18%)
WD40 repeat 638..715 CDD:293791 23/97 (24%)
WD40 repeat 724..770 CDD:293791
WD40 repeat 777..799 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.