Sequence 1: | NP_611493.2 | Gene: | Hil / 37328 | FlyBaseID: | FBgn0050147 | Length: | 818 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380866.1 | Gene: | MICAL2 / 9645 | HGNCID: | 24693 | Length: | 1957 | Species: | Homo sapiens |
Alignment Length: | 286 | Identity: | 61/286 - (21%) |
---|---|---|---|
Similarity: | 85/286 - (29%) | Gaps: | 109/286 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 TCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHV---- 70
Fly 71 ----PKSGPGHLDQ--TSVGIRQALNAPRTNKFVNEQIRGTRSE----------VDGGP------ 113
Fly 114 ---------------LGGSRQSTPNGYGSREI-------------------SSPSQNDSDYKYGR 144
Fly 145 FDASALHIAHALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDR 209
Fly 210 KIQ------DEFQ-------DEWERE 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hil | NP_611493.2 | LIM_Ltd-1 | 11..70 | CDD:188827 | 19/58 (33%) |
BAR | <147..>265 | CDD:299863 | 20/89 (22%) | ||
TGc | 418..486 | CDD:214673 | |||
MICAL2 | NP_001380866.1 | Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 | 2..494 | ||
UbiH | 87..>226 | CDD:357568 | |||
CH | 522..617 | CDD:214479 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 660..714 | ||||
Nuclear localization signal. /evidence=ECO:0000269|PubMed:24440334 | 660..681 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 886..942 | ||||
LIM_Mical | 1002..1056 | CDD:188823 | 19/58 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1072..1094 | 8/30 (27%) | |||
PHA03247 | <1087..1624 | CDD:223021 | 37/195 (19%) | ||
ProQ | 1628..1718 | CDD:198013 | |||
DUF5401 | <1773..>1944 | CDD:375164 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1700 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |