DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and PLIM2b

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_171683.1 Gene:PLIM2b / 839267 AraportID:AT1G01780 Length:205 Species:Arabidopsis thaliana


Alignment Length:92 Identity:26/92 - (28%)
Similarity:39/92 - (42%) Gaps:19/92 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSH--- 69
            :..|..|.:|||.::::  ..:...||..||:|.|.|..||..:|.:.     |..:||..|   
plant   101 QDKCAACEKTVYPLEKI--QMEGECFHKTCFRCAHGGCTLTHSSYASL-----DSVLYCRHHFNQ 158

  Fly    70 --VPKSGPGHLDQTSVGIRQALNAPRT 94
              :.|....|       :.||.|..||
plant   159 LFMEKGNYAH-------VLQAANHRRT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 19/63 (30%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
PLIM2bNP_171683.1 LIM1_SF3 6..68 CDD:188824
LIM 104..164 CDD:413332 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.