DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and WLIM1

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:111 Identity:27/111 - (24%)
Similarity:47/111 - (42%) Gaps:36/111 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NFYEST---CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYC 66
            |.:..|   |:.|.:|||.:::|.  .:.|.:|..||||.|.|..::...|..::.|     :||
plant   101 NMFGGTREKCVGCDKTVYPIEKVS--VNGTLYHKSCFKCTHGGCTISPSNYIAHEGK-----LYC 158

  Fly    67 SSHVPKSGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGG 112
            ..|       |:                 :.:.|  :|..|:::||
plant   159 KHH-------HI-----------------QLIKE--KGNLSQLEGG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 18/58 (31%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824
LIM2_SF3 110..170 CDD:188825 21/92 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.