DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and WLIM2a

DIOPT Version :10

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:62 Identity:21/62 - (33%)
Similarity:29/62 - (46%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSH 69
            :..|..|.:|||.|:.:.  .|...:|..||||.||.::|.|..|     ...:..|||..|
plant     7 QQKCRACEKTVYPVELLS--ADGISYHKACFKCSHCKSRLQLSNY-----SSMEGVVYCRPH 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 21/59 (36%)
PTZ00121 <144..327 CDD:173412
CYK3 <342..550 CDD:444090
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 21/62 (34%)
LIM2_SF3 109..169 CDD:188825
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.