DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and lima1

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001072345.1 Gene:lima1 / 779798 XenbaseID:XB-GENE-987339 Length:715 Species:Xenopus tropicalis


Alignment Length:381 Identity:88/381 - (23%)
Similarity:153/381 - (40%) Gaps:100/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPK--S 73
            |..|.:|||.::|:  ..:...:|:|||:|.||.|||:|.| |.:.|    ..|||..|..:  .
 Frog   354 CFSCQKTVYPMERL--FANNQVYHNGCFRCSHCSTKLSLGT-FASLH----GTVYCKPHFNQLFK 411

  Fly    74 GPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGGPLGGSRQSTPNGYGSREISSPSQNDS 138
            ..|:.|: ..|     :.|....:||   :...||.:..|    .|:|  .:.|::.|||...::
 Frog   412 SKGNYDE-GFG-----HKPHKELWVN---KTETSETEESP----EQTT--AHISKDPSSPVVEEA 461

  Fly   139 DY-KYGRFDASALHIAHALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRK-------EEDD 195
            .. |.|...||             .:|.|.:         |::::..:|.|..|       |...
 Frog   462 PIAKVGVLAAS-------------MEAKNSS---------AQDKEKQVETKRLKIAWPPPAESSG 504

  Fly   196 LYRKFASKRAEEDRKIQDEFQDEWE--RELQRLTHKFEKELATSRRS-----RDEANILTMRHEQ 253
                 |....||:.|:   .:.:|.  .|:|::..:.:.:|...|||     |..|.||::....
 Frog   505 -----AGGSGEENIKV---LRPKWPPVEEIQKVETEEDLDLKKLRRSGSLRERSRAYILSVAKPV 561

  Fly   254 QKEDLEKNMTLRRSKKKESITRKMLEH--ERYETAALVDRQSSEMLELISARRSEYMQSESIFLD 316
            ..:....|:.....|.|:|.:.|:.:.  ::.|     :|||.|.    ..:.|:.::..|:..:
 Frog   562 DSDKALDNLPASPPKLKKSNSFKLRDTWIKKPE-----ERQSVEE----ENKPSQDIKDVSVVAE 617

  Fly   317 DEFSEGAVPVEYPLNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTD 372
            |:                .|.||    .:....:|.|||.:|.::..|...:..|:
 Frog   618 DK----------------EANPA----DLADKVLESEDVSKIEVAEQQHSPEESTE 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 23/58 (40%)
BAR <147..>265 CDD:299863 25/131 (19%)
TGc 418..486 CDD:214673
lima1NP_001072345.1 LIM_Eplin_alpha_beta 354..406 CDD:188869 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.