DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hil and Crip2

DIOPT Version :9

Sequence 1:	NP_611493.2	Gene:	Hil / 37328	FlyBaseID:	FBgn0050147	Length:	818	Species:	Drosophila melanogaster
Sequence 2:	NP_077185.1	Gene:	Crip2 / 68337	MGIID:	1915587	Length:	208	Species:	Mus musculus

Alignment Length:	142	Identity:	37/142 - (26%)
Similarity:	54/142 - (38%)	Gaps:	20/142 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 STCLRCSETVYQVDRVGPL-KDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVP- 71
            |.|.:|.:|||..::|..| ||   :|..|.||..|.     ||.....|.:.|.:.:|  |.|
Mouse     3 SKCPKCDKTVYFAEKVSSLGKD---WHKFCLKCERCN-----KTLTPGGHAEHDGKPFC--HKPC 57

  Fly    72 ---KSGPGHLDQTSVGI----RQALNAPR-TNKFVNEQIRGTRSEVDGGPLGGSRQSTPNGYGSR 128
               ..||..::....|.    :....||: |.......:|....:..|.|.|.|:.|:...:...
Mouse    58 YATLFGPKGVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVRTEERKTSGPPKGPSKASSVTTFTGE 122

  Fly   129 EISSPSQNDSDY 140
            ....|..|...|
Mouse   123 PNMCPRCNKRVY 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hil	NP_611493.2	LIM_Ltd-1	11..70	CDD:188827	19/59 (32%)
		BAR	<147..>265	CDD:299863
		TGc	418..486	CDD:214673
Crip2	NP_077185.1	LIM1_TLP	5..58	CDD:188860	21/62 (34%)
Crip2	NP_077185.1	LIM1_TLP	126..179	CDD:188860	3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810