DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and Limd2

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001343387.1 Gene:Limd2 / 67803 MGIID:1915053 Length:128 Species:Mus musculus


Alignment Length:75 Identity:27/75 - (36%)
Similarity:39/75 - (52%) Gaps:9/75 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPK 72
            :.||..|.:|||.::|:  :.|...||:.||.|.||.|||:|.:| ...|    .|.||..|..:
Mouse    38 KETCAACQKTVYPMERL--VADKLIFHNSCFCCKHCHTKLSLGSY-AAMH----GEFYCRPHFQQ 95

  Fly    73 --SGPGHLDQ 80
              ...|:.|:
Mouse    96 LFKSKGNYDE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 23/58 (40%)
BAR <147..>265 CDD:299863
TGc 418..486 CDD:214673
Limd2NP_001343387.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
LIM_Eplin_like_1 41..93 CDD:188870 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.