DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hil and mical1

DIOPT Version :9

Sequence 1:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001303659.1 Gene:mical1 / 568573 ZFINID:ZDB-GENE-081022-3 Length:1214 Species:Danio rerio


Alignment Length:437 Identity:81/437 - (18%)
Similarity:127/437 - (29%) Gaps:171/437 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSH------ 69
            |..|.:.:|.|:|..  .:..|||..||.|..||:.|....|   ....|:...||..|      
Zfish   688 CYFCKKHLYVVERES--AEGKFFHRSCFNCFQCGSTLRQGGY---SFHSDNGRFYCELHSLAEEE 747

  Fly    70 --------------------------VPKSGPGHLDQTSVG------------------------ 84
                                      ...|.|.||.....|                        
Zfish   748 EGDEGHGGAQNHTENGSKEDKNGETTAASSPPAHLSIKRKGSYKISVDPDFDESTEFPAPDQDEP 812

  Fly    85 --IRQALNAPRTNKFVNEQIRGTRSEVDGGPL---GGSRQSTPNGYGSREI-------------- 130
              :.::...|:.::...|.......:.:..|:   .|||...|.......:              
Zfish   813 PDLEESHQPPKPSELSAENTNMENQQHNINPVPAPRGSRAPLPKPRTVHNVVHEPCNIPEEAEQI 877

  Fly   131 -----SSPS---------------QNDSDYKYGRFDASALHIAHALKQTEIQ----------KAY 165
                 ..||               ..|||.: .|..:||...:.:.||.|.:          |::
Zfish   878 PEEPKPKPSLRKLQQSEEEKVDLLSQDSDSE-TRGSSSAASTSSSSKQHEEEGYWSGGTTWGKSH 941

  Fly   166 NKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKF-----ASKRAE------------------- 206
            .:.|.:|.   :.|:.:..|.:....:...:..||     :|.|.:                   
Zfish   942 REQRNRPC---IRRKSEPPLPLTGHSQHGKMRSKFSPWNLSSPRLQQRFSVHRVPAGQSQPDQYV 1003

  Fly   207 -EDRKIQDEFQDEWERELQRLTHKFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKK 270
             ||....||  ||.|.:|| ..|..:.|.|....|           :.:|.:|::..||.|.   
Zfish  1004 SEDDNEDDE--DEDEEDLQ-AEHYLDCEGADFEFS-----------DSEKRNLKRMKTLERK--- 1051

  Fly   271 ESITRKMLEHERYETAALVDRQSSEM-----------LELISARRSE 306
                .||.|.:|:..|..:.|:..|:           :||..|.|.|
Zfish  1052 ----AKMTEIQRFHKAQSIQRRLEEIEVTFKELEEKGVELERALRGE 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 19/90 (21%)
BAR <147..>265 CDD:299863 30/152 (20%)
TGc 418..486 CDD:214673
mical1NP_001303659.1 Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 1..488
NAD_binding_8 90..>133 CDD:290186
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..505
CH 512..609 CDD:278723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..676
LIM_Mical 688..742 CDD:188823 18/58 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..1019 39/277 (14%)
DUF3585 1062..1193 CDD:288945 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1194..1214
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.